SimulationCraft 902-01

for World of Warcraft 9.0.2.36532 Live (wow build level 36532)

Beta Release

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-10-25 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00
2020-09-20 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

Kyrian_Forgelite : 10127 dps, 4319 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
10126.8 10126.8 11.7 / 0.115% 891.5 / 8.8% 5.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
1992.9 1896.0 Mana 0.00% 49.4 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_Forgelite 10127
Arcane Barrage 2788 27.5% 55.6 5.42sec 15107 12120 Direct 166.5 4225 8492 5043 19.2%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 55.58 166.52 0.00 0.00 1.2464 0.0000 839637.00 839637.00 0.00% 12120.35 12120.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.82% 134.58 97 172 4224.72 2082 13116 4222.39 3806 4583 568496 568496 0.00%
crit 19.18% 31.94 15 55 8491.82 4164 26233 8485.94 6012 11232 271141 271141 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [r]:55.58
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 372 3.7% 59.3 4.71sec 1887 0 Direct 177.8 528 1054 629 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 59.27 177.80 0.00 0.00 0.0000 0.0000 111850.92 111850.92 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 143.53 98 195 527.65 316 664 527.22 482 573 75724 75724 0.00%
crit 19.28% 34.27 15 57 1054.24 633 1329 1053.04 908 1198 36127 36127 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 5029 49.7% 149.3 1.98sec 10138 8158 Direct 448.0 2831 5666 3380 19.4%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 149.33 448.00 0.00 0.00 1.2426 0.0000 1513898.20 1513898.20 0.00% 8158.36 8158.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 361.30 276 447 2831.12 2128 6257 2831.21 2712 2945 1022758 1022758 0.00%
crit 19.35% 86.70 52 125 5665.84 4256 12513 5665.84 5109 6424 491141 491141 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.546000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 54.6%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [q]:149.32
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (841) 0.0% (8.3%) 12.8 24.14sec 19743 15847

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.83 0.00 0.00 0.00 1.2459 0.0000 0.00 0.00 0.00% 15847.09 15847.09

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [p]:12.83
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 841 8.3% 38.4 24.14sec 6591 0 Direct 38.4 5530 11035 6592 19.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.44 38.44 0.00 0.00 0.0000 0.0000 253331.62 253331.62 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 31.02 15 43 5530.25 3869 8938 5529.97 4886 6056 171567 171567 0.00%
crit 19.28% 7.41 1 18 11035.10 7739 17876 11021.41 7739 17876 81764 81764 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (69) 0.0% (0.7%) 14.8 1.78sec 1385 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.76 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 69 0.7% 14.8 1.78sec 1385 0 Direct 14.8 1164 2327 1385 19.0%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.76 14.76 0.00 0.00 0.0000 0.0000 20443.92 20443.92 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.96% 11.95 5 20 1163.53 1164 1164 1163.53 1164 1164 13903 13903 0.00%
crit 19.04% 2.81 0 10 2327.06 2327 2327 2220.11 0 2327 6541 6541 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1758 18.5%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1754.84 1754.84 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.48% 0.81 0 1 1480.68 1481 1481 1206.51 0 1481 1207 1207 0.00%
crit 18.52% 0.19 0 1 2961.35 2961 2961 548.33 0 2961 548 548 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 6087 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 152  / 20 0.2% 90.0 1.29sec 68 52 Direct 90.0 57 114 68 19.1%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6087.20 6087.20 0.00% 51.68 51.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.92% 72.82 58 86 56.80 43 60 56.80 56 58 4137 4137 0.00%
crit 19.08% 17.18 4 32 113.58 86 120 113.56 101 120 1951 1951 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Radiant Spark 188 1.9% 9.3 34.02sec 6098 4787 Direct 9.3 3043 6072 3621 19.1%
Periodic 60.5 319 640 381 19.2% 10.1%

Stats Details: Radiant Spark

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.30 9.30 60.50 60.50 1.2738 1.5118 56730.31 56730.31 0.00% 549.07 4787.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.93% 7.53 2 11 3043.41 2693 5655 3043.68 2693 3878 22909 22909 0.00%
crit 19.07% 1.77 0 7 6072.35 5386 11310 5267.71 0 11310 10771 10771 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.81% 48.89 33 66 319.46 34 501 319.01 280 354 15617 15617 0.00%
crit 19.19% 11.61 2 24 640.06 68 1003 639.66 383 1003 7433 7433 0.00%

Action Details: Radiant Spark

  • id:307443
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.760000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.082400
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:307443
  • name:Radiant Spark
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Conjure a radiant spark that causes {$s1=0 + 76.0%} Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes {$307454s1=10}% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells.

Action Priority List

    aoe
    [j]:4.55
  • if_expr:cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
    aoe
    [k]:3.80
  • if_expr:cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
    aoe
    [l]:0.99
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Touch of the Magi 0 (798) 0.0% (7.9%) 5.9 54.75sec 40420 32182

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.94 0.00 0.00 0.00 1.2560 0.0000 0.00 0.00 0.00% 32181.71 32181.71

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [m]:5.96
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 798 7.9% 5.9 54.64sec 40420 0 Direct 17.8 13500 0 13500 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.94 17.79 0.00 0.00 0.0000 0.0000 240075.57 240075.57 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 17.79 15 21 13499.85 109 46437 13505.97 9778 16663 240076 240076 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11903.20
  • base_dd_max:11903.20
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
pet - bron 73 / 15
melee 73 0.2% 18.9 9.04sec 242 186 Direct 18.9 202 406 242 19.6%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.88 18.88 0.00 0.00 1.3019 0.0000 4576.03 6536.40 29.99% 186.15 186.15
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.40% 15.18 8 25 202.41 176 247 202.24 176 229 3073 4390 29.99%
crit 19.60% 3.70 0 11 406.19 353 494 399.21 0 494 1503 2147 29.50%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
Kyrian_Forgelite
Arcane Power 2.8 131.46sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [n]:2.81
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 262.76sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [v]:1.81
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.0 177.68sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.01 0.00 6.02 0.00 4.3016 0.7220 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [s]:1.01
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [u]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 5.8 53.02sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.79 0.00 0.00 0.00 1.2547 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [o]:5.81
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 123.11sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.76 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [t]:2.76
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
pet - bron
Anima Cannon 8.4 22.10sec

Stats Details: Anima Cannon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.35 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Anima Cannon

  • id:332525
  • school:arcane
  • range:100.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:8.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:332525
  • name:Anima Cannon
  • school:arcane
  • tooltip:
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}

Action Priority List

    default
    [ ]:8.35
Vitalizing Bolt (goliath_support) 14.6 11.94sec

Stats Details: Goliath Support

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 14.63 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Goliath Support

  • id:332526
  • school:arcane
  • range:100.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:4.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite_bron
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:332526
  • name:Vitalizing Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}

Action Priority List

    default
    [ ]:14.63
Smash 8.3 22.30sec

Stats Details: Smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.27 0.00 0.00 0.00 2.1709 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Smash

  • id:341163
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:3.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:341163
  • name:Smash
  • school:physical
  • tooltip:
  • description:Attacks the ground with a heavy smash, inflicting Arcane damage to all enemies in a cone in front of the caster.

Action Priority List

    default
    [ ]:8.35

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 56.3 150.2 5.3sec 1.4sec 3.9sec 72.17% 0.00% 0.1 (0.2) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s

Stack Uptimes

  • arcane_charge_1:18.70%
  • arcane_charge_2:16.06%
  • arcane_charge_3:16.05%
  • arcane_charge_4:21.36%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 131.6sec 131.6sec 14.7sec 13.62% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.4s / 138.9s
  • trigger_min/max:120.4s / 138.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:13.62%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 262.9sec 262.9sec 11.7sec 6.91% 23.36% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:241.0s / 272.2s
  • trigger_min/max:241.0s / 272.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • berserking_1:6.91%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.46% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.46%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bron's Call to Action 3.2 238.9 110.3sec 1.2sec 92.8sec 99.05% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_brons_call_to_action
  • max_stacks:89
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:100.0s / 120.9s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 120.8s

Stack Uptimes

  • brons_call_to_action_1:1.58%
  • brons_call_to_action_2:1.33%
  • brons_call_to_action_3:0.81%
  • brons_call_to_action_4:0.95%
  • brons_call_to_action_5:0.95%
  • brons_call_to_action_6:1.40%
  • brons_call_to_action_7:1.28%
  • brons_call_to_action_8:1.22%
  • brons_call_to_action_9:1.23%
  • brons_call_to_action_10:1.28%
  • brons_call_to_action_11:1.51%
  • brons_call_to_action_12:1.06%
  • brons_call_to_action_13:1.66%
  • brons_call_to_action_14:1.15%
  • brons_call_to_action_15:0.79%
  • brons_call_to_action_16:1.20%
  • brons_call_to_action_17:1.19%
  • brons_call_to_action_18:1.21%
  • brons_call_to_action_19:1.23%
  • brons_call_to_action_20:1.21%
  • brons_call_to_action_21:1.19%
  • brons_call_to_action_22:1.59%
  • brons_call_to_action_23:0.86%
  • brons_call_to_action_24:1.03%
  • brons_call_to_action_25:1.19%
  • brons_call_to_action_26:1.22%
  • brons_call_to_action_27:1.54%
  • brons_call_to_action_28:0.88%
  • brons_call_to_action_29:0.70%
  • brons_call_to_action_30:1.06%
  • brons_call_to_action_31:1.16%
  • brons_call_to_action_32:1.16%
  • brons_call_to_action_33:1.11%
  • brons_call_to_action_34:1.29%
  • brons_call_to_action_35:1.11%
  • brons_call_to_action_36:1.29%
  • brons_call_to_action_37:0.58%
  • brons_call_to_action_38:0.90%
  • brons_call_to_action_39:1.08%
  • brons_call_to_action_40:1.06%
  • brons_call_to_action_41:1.06%
  • brons_call_to_action_42:1.04%
  • brons_call_to_action_43:1.03%
  • brons_call_to_action_44:1.04%
  • brons_call_to_action_45:1.06%
  • brons_call_to_action_46:1.16%
  • brons_call_to_action_47:1.22%
  • brons_call_to_action_48:1.15%
  • brons_call_to_action_49:1.12%
  • brons_call_to_action_50:1.11%
  • brons_call_to_action_51:1.13%
  • brons_call_to_action_52:1.41%
  • brons_call_to_action_53:1.18%
  • brons_call_to_action_54:1.13%
  • brons_call_to_action_55:0.94%
  • brons_call_to_action_56:1.02%
  • brons_call_to_action_57:1.14%
  • brons_call_to_action_58:1.08%
  • brons_call_to_action_59:1.11%
  • brons_call_to_action_60:1.13%
  • brons_call_to_action_61:1.15%
  • brons_call_to_action_62:1.07%
  • brons_call_to_action_63:1.09%
  • brons_call_to_action_64:1.56%
  • brons_call_to_action_65:1.09%
  • brons_call_to_action_66:1.10%
  • brons_call_to_action_67:0.54%
  • brons_call_to_action_68:1.07%
  • brons_call_to_action_69:1.08%
  • brons_call_to_action_70:1.10%
  • brons_call_to_action_71:1.18%
  • brons_call_to_action_72:1.00%
  • brons_call_to_action_73:1.08%
  • brons_call_to_action_74:1.00%
  • brons_call_to_action_75:1.04%
  • brons_call_to_action_76:1.24%
  • brons_call_to_action_77:0.80%
  • brons_call_to_action_78:1.03%
  • brons_call_to_action_79:1.04%
  • brons_call_to_action_80:1.02%
  • brons_call_to_action_81:1.01%
  • brons_call_to_action_82:1.05%
  • brons_call_to_action_83:1.07%
  • brons_call_to_action_84:1.05%
  • brons_call_to_action_85:1.02%
  • brons_call_to_action_86:1.13%
  • brons_call_to_action_87:1.03%
  • brons_call_to_action_88:1.40%
  • brons_call_to_action_89:0.54%

Spelldata

  • id:332514
  • name:Bron's Call to Action
  • tooltip:Bron arrives in ${{$332514u=89}+1-$w1} damaging or healing spells or abilities.
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}
  • max_stacks:89
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 23.9 0.2 12.2sec 12.1sec 2.1sec 16.47% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.25%
  • clearcasting_2:0.22%
  • clearcasting_3:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 1.0 0.0 172.1sec 172.1sec 4.3sec 1.45% 0.00% 4.0 (4.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:95.8s / 244.7s
  • trigger_min/max:95.8s / 244.7s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 4.3s

Stack Uptimes

  • evocation_1:1.45%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.41% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.41%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.6 0.0 36.6sec 36.6sec 14.6sec 41.74% 0.00% 0.0 (0.0) 8.2

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:16.8s / 55.3s
  • trigger_min/max:16.8s / 55.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:41.74%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.42% 0.82% 7.08% 0.9s 0.0s 6.0s
Conserve Phase 100.00% 100.00% 100.00% 301.2s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000181.223120.154239.984
Evocation166.9885.796336.588226.052138.544359.245
Rune of Power8.5811.14229.92551.88531.84177.491
Touch of the Magi7.0981.14229.91744.60830.53576.185
Arcane Power8.2740.37018.90723.7302.70434.472
Arcane Barrage2.9240.0029.588163.639129.105198.367
Arcane Orb4.0890.01411.79452.99440.32768.934
Radiant Spark2.4050.00025.18423.1199.70558.193

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_Forgelite
mana_regen Mana 624.92 370285.09 64.83% 592.54 10871.10 2.85%
Evocation Mana 48.20 48543.28 8.50% 1007.02 0.00 0.00%
Mana Gem Mana 2.76 17487.88 3.06% 6337.14 0.00 0.00%
Arcane Barrage Mana 55.58 134851.19 23.61% 2426.38 6028.56 4.28%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1895.99 1992.93 16871.2 34172.3 888.1 63371.4
Usage Type Count Total Avg RPE APR
Kyrian_Forgelite
arcane_explosion Mana 149.3 569551.7 3814.3 3813.9 2.7
arcane_orb Mana 12.8 5735.4 446.9 447.0 44.2
radiant_spark Mana 9.3 9171.9 985.8 985.9 6.2
touch_of_the_magi Mana 5.9 14848.9 2500.0 2500.0 16.2

Statistics & Data Analysis

Fight Length
Kyrian_Forgelite Fight Length
Count 1523
Mean 301.22
Minimum 240.15
Maximum 359.98
Spread ( max - min ) 119.83
Range [ ( max - min ) / 2 * 100% ] 19.89%
DPS
Kyrian_Forgelite Damage Per Second
Count 1523
Mean 10126.78
Minimum 9425.74
Maximum 10822.56
Spread ( max - min ) 1396.82
Range [ ( max - min ) / 2 * 100% ] 6.90%
Standard Deviation 232.5434
5th Percentile 9764.96
95th Percentile 10520.31
( 95th Percentile - 5th Percentile ) 755.35
Mean Distribution
Standard Deviation 5.9587
95.00% Confidence Interval ( 10115.10 - 10138.46 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2026
0.1 Scale Factor Error with Delta=300 462
0.05 Scale Factor Error with Delta=300 1847
0.01 Scale Factor Error with Delta=300 46163
Priority Target DPS
Kyrian_Forgelite Priority Target Damage Per Second
Count 1523
Mean 4319.38
Minimum 3890.08
Maximum 4807.23
Spread ( max - min ) 917.15
Range [ ( max - min ) / 2 * 100% ] 10.62%
Standard Deviation 131.7665
5th Percentile 4114.88
95th Percentile 4531.64
( 95th Percentile - 5th Percentile ) 416.76
Mean Distribution
Standard Deviation 3.3764
95.00% Confidence Interval ( 4312.76 - 4325.99 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3575
0.1 Scale Factor Error with Delta=300 149
0.05 Scale Factor Error with Delta=300 593
0.01 Scale Factor Error with Delta=300 14822
DPS(e)
Kyrian_Forgelite Damage Per Second (Effective)
Count 1523
Mean 10126.78
Minimum 9425.74
Maximum 10822.56
Spread ( max - min ) 1396.82
Range [ ( max - min ) / 2 * 100% ] 6.90%
Damage
Kyrian_Forgelite Damage
Count 1523
Mean 3037722.38
Minimum 2359673.58
Maximum 3728799.66
Spread ( max - min ) 1369126.09
Range [ ( max - min ) / 2 * 100% ] 22.54%
DTPS
Kyrian_Forgelite Damage Taken Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_Forgelite Healing Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_Forgelite Healing Per Second (Effective)
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_Forgelite Heal
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_Forgelite Healing Taken Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_Forgelite Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_ForgeliteTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_Forgelite Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
j 4.55 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
k 3.80 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
l 0.99 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
m 5.96 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
n 2.81 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
o 5.81 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
p 12.83 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
q 149.32 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
r 55.58 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
s 1.01 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
t 2.76 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
u 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
v 1.81 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYkmnuvrprqqqqrqqqqrqqqqorqqqqtrprqqqqrjqqqqrqqqqrqqqqrprqqqqrqqqqrkmorprqqqqrqqqqrqqqqrprqjqqqrqqqqrqqqqrmorprqqqqrqqqqlnrqqqqrtprqqqqrqqqqrqqqqrkmorprqqqqrqqqqrqqqqrprqjqqqrqqqqrqqqqrmorprqqqqrjqqqqrqqqsqrprqqqqrqqqqrtkmnvrqqqqrprqqqqrqqqqorqqqqrjprqqqqrqqqqrqqqqrprqqqqrqqqqrkmorprqqqqrqqqqr

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Kyrian_Forgelite 63371.4/63371: 100% mana
Pre precombat R food Kyrian_Forgelite 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe k radiant_spark Fluffy_Pillow 62371.4/63371: 98% mana
0:01.306 aoe m touch_of_the_magi Fluffy_Pillow 62376.5/63371: 98% mana bloodlust
0:02.312 aoe n arcane_power Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4)
0:02.312 shared_cds u potion Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:02.312 shared_cds v berserking Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.312 aoe r arcane_barrage Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.227 aoe p arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.141 aoe r arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.055 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.968 aoe q arcane_explosion Fluffy_Pillow 62028.6/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.882 aoe q arcane_explosion Fluffy_Pillow 60687.0/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.798 aoe q arcane_explosion Fluffy_Pillow 59348.0/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.711 aoe r arcane_barrage Fluffy_Pillow 58005.1/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.626 aoe q arcane_explosion Fluffy_Pillow 61699.7/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.539 aoe q arcane_explosion Fluffy_Pillow 60356.9/63371: 95% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.453 aoe q arcane_explosion Fluffy_Pillow 59015.3/63371: 93% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.368 aoe q arcane_explosion Fluffy_Pillow 57675.0/63371: 91% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.281 aoe r arcane_barrage Fluffy_Pillow 56332.2/63371: 89% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.195 aoe q arcane_explosion Fluffy_Pillow 60025.4/63371: 95% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:15.110 aoe q arcane_explosion Fluffy_Pillow 58685.1/63371: 93% mana bloodlust, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:16.115 aoe q arcane_explosion Fluffy_Pillow 57458.9/63371: 91% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:17.123 aoe q arcane_explosion Fluffy_Pillow 56236.5/63371: 89% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:18.128 aoe o rune_of_power Fluffy_Pillow 55010.2/63371: 87% mana bloodlust, arcane_charge(4), clearcasting, potion_of_deathly_fixation
0:19.135 aoe r arcane_barrage Fluffy_Pillow 56286.5/63371: 89% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:20.140 aoe q arcane_explosion Fluffy_Pillow 60095.2/63371: 95% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:21.148 aoe q arcane_explosion Fluffy_Pillow 61372.7/63371: 97% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:22.153 aoe q arcane_explosion Fluffy_Pillow 57646.5/63371: 91% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:23.158 aoe q arcane_explosion Fluffy_Pillow 53920.3/63371: 85% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:24.165 shared_cds t use_mana_gem Kyrian_Forgelite 50196.6/63371: 79% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:24.165 aoe r arcane_barrage Fluffy_Pillow 56533.7/63371: 89% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:25.171 aoe p arcane_orb Fluffy_Pillow 60343.6/63371: 95% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:26.176 aoe r arcane_barrage Fluffy_Pillow 61117.4/63371: 96% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:27.183 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:28.188 aoe q arcane_explosion Fluffy_Pillow 59645.2/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:29.194 aoe q arcane_explosion Fluffy_Pillow 55920.2/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power
0:30.199 aoe q arcane_explosion Fluffy_Pillow 52194.0/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power
0:31.206 aoe r arcane_barrage Fluffy_Pillow 48470.3/63371: 76% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power
0:32.214 aoe j radiant_spark Fluffy_Pillow 52282.7/63371: 83% mana bloodlust, clearcasting, rune_of_power
0:33.221 aoe q arcane_explosion Fluffy_Pillow 52559.0/63371: 83% mana bloodlust, clearcasting, rune_of_power
0:34.229 aoe q arcane_explosion Fluffy_Pillow 53836.6/63371: 85% mana bloodlust, arcane_charge
0:35.235 aoe q arcane_explosion Fluffy_Pillow 50111.6/63371: 79% mana bloodlust, arcane_charge(2)
0:36.240 aoe q arcane_explosion Fluffy_Pillow 46385.4/63371: 73% mana bloodlust, arcane_charge(3)
0:37.248 aoe r arcane_barrage Fluffy_Pillow 42663.0/63371: 67% mana bloodlust, arcane_charge(4)
0:38.255 aoe q arcane_explosion Fluffy_Pillow 46474.1/63371: 73% mana bloodlust
0:39.262 aoe q arcane_explosion Fluffy_Pillow 42750.4/63371: 67% mana bloodlust, arcane_charge
0:40.269 aoe q arcane_explosion Fluffy_Pillow 39026.7/63371: 62% mana bloodlust, arcane_charge(2)
0:41.276 aoe q arcane_explosion Fluffy_Pillow 35303.0/63371: 56% mana arcane_charge(3)
0:42.584 aoe r arcane_barrage Fluffy_Pillow 31960.8/63371: 50% mana arcane_charge(4)
0:43.892 aoe q arcane_explosion Fluffy_Pillow 36153.5/63371: 57% mana
0:45.199 aoe q arcane_explosion Fluffy_Pillow 32810.0/63371: 52% mana arcane_charge
0:46.504 aoe q arcane_explosion Fluffy_Pillow 29464.0/63371: 46% mana arcane_charge(2), clearcasting
0:47.812 aoe q arcane_explosion Fluffy_Pillow 31121.8/63371: 49% mana arcane_charge(3)
0:49.119 aoe r arcane_barrage Fluffy_Pillow 27778.3/63371: 44% mana arcane_charge(4), clearcasting
0:50.423 aoe p arcane_orb Fluffy_Pillow 31965.9/63371: 50% mana clearcasting
0:51.729 aoe r arcane_barrage Fluffy_Pillow 33121.2/63371: 52% mana arcane_charge(4), clearcasting
0:53.036 aoe q arcane_explosion Fluffy_Pillow 37312.5/63371: 59% mana clearcasting
0:54.342 aoe q arcane_explosion Fluffy_Pillow 38967.8/63371: 61% mana arcane_charge
0:55.647 aoe q arcane_explosion Fluffy_Pillow 35621.8/63371: 56% mana arcane_charge(2)
0:56.956 aoe q arcane_explosion Fluffy_Pillow 32280.9/63371: 51% mana arcane_charge(3), clearcasting
0:58.264 aoe r arcane_barrage Fluffy_Pillow 33938.7/63371: 54% mana arcane_charge(4)
0:59.571 aoe q arcane_explosion Fluffy_Pillow 38130.0/63371: 60% mana
1:00.878 aoe q arcane_explosion Fluffy_Pillow 34786.6/63371: 55% mana arcane_charge
1:02.183 aoe q arcane_explosion Fluffy_Pillow 31440.6/63371: 50% mana arcane_charge(2)
1:03.490 aoe q arcane_explosion Fluffy_Pillow 28097.1/63371: 44% mana arcane_charge(3)
1:04.796 aoe r arcane_barrage Fluffy_Pillow 24752.4/63371: 39% mana arcane_charge(4)
1:06.102 aoe k radiant_spark Fluffy_Pillow 28942.5/63371: 46% mana
1:07.409 aoe m touch_of_the_magi Fluffy_Pillow 29599.0/63371: 47% mana clearcasting
1:08.715 aoe o rune_of_power Fluffy_Pillow 28754.3/63371: 45% mana arcane_charge(4), clearcasting
1:10.021 aoe r arcane_barrage Fluffy_Pillow 30409.5/63371: 48% mana arcane_charge(4), clearcasting, rune_of_power
1:11.326 aoe p arcane_orb Fluffy_Pillow 34598.4/63371: 55% mana clearcasting, rune_of_power
1:12.632 aoe r arcane_barrage Fluffy_Pillow 35753.6/63371: 56% mana arcane_charge(4), clearcasting, rune_of_power
1:13.937 aoe q arcane_explosion Fluffy_Pillow 39942.5/63371: 63% mana clearcasting, rune_of_power
1:15.243 aoe q arcane_explosion Fluffy_Pillow 41597.8/63371: 66% mana arcane_charge, rune_of_power
1:16.549 aoe q arcane_explosion Fluffy_Pillow 38253.0/63371: 60% mana arcane_charge(2), rune_of_power
1:17.857 aoe q arcane_explosion Fluffy_Pillow 34910.8/63371: 55% mana arcane_charge(3), clearcasting, rune_of_power
1:19.163 aoe r arcane_barrage Fluffy_Pillow 36566.1/63371: 58% mana arcane_charge(4), rune_of_power
1:20.471 aoe q arcane_explosion Fluffy_Pillow 40758.7/63371: 64% mana rune_of_power
1:21.778 aoe q arcane_explosion Fluffy_Pillow 37415.3/63371: 59% mana arcane_charge, clearcasting, rune_of_power
1:23.084 aoe q arcane_explosion Fluffy_Pillow 39070.5/63371: 62% mana arcane_charge(2), rune_of_power
1:24.391 aoe q arcane_explosion Fluffy_Pillow 35727.1/63371: 56% mana arcane_charge(3), clearcasting, rune_of_power
1:25.697 aoe r arcane_barrage Fluffy_Pillow 37382.3/63371: 59% mana arcane_charge(4)
1:27.003 aoe q arcane_explosion Fluffy_Pillow 41572.4/63371: 66% mana
1:28.307 aoe q arcane_explosion Fluffy_Pillow 38225.2/63371: 60% mana arcane_charge
1:29.613 aoe q arcane_explosion Fluffy_Pillow 34880.4/63371: 55% mana arcane_charge(2)
1:30.919 aoe q arcane_explosion Fluffy_Pillow 31535.7/63371: 50% mana arcane_charge(3)
1:32.225 aoe r arcane_barrage Fluffy_Pillow 28190.9/63371: 44% mana arcane_charge(4)
1:33.532 aoe p arcane_orb Fluffy_Pillow 32382.3/63371: 51% mana
1:34.839 aoe r arcane_barrage Fluffy_Pillow 33538.9/63371: 53% mana arcane_charge(4)
1:36.146 aoe q arcane_explosion Fluffy_Pillow 37730.2/63371: 60% mana
1:37.451 aoe j radiant_spark Fluffy_Pillow 34384.2/63371: 54% mana arcane_charge
1:38.757 aoe q arcane_explosion Fluffy_Pillow 35039.5/63371: 55% mana arcane_charge, clearcasting
1:40.063 aoe q arcane_explosion Fluffy_Pillow 36694.8/63371: 58% mana arcane_charge(2)
1:41.369 aoe q arcane_explosion Fluffy_Pillow 33350.0/63371: 53% mana arcane_charge(3), clearcasting, brons_call_to_action
1:42.675 aoe r arcane_barrage Fluffy_Pillow 35005.3/63371: 55% mana arcane_charge(4), brons_call_to_action(2)
1:43.982 aoe q arcane_explosion Fluffy_Pillow 39196.7/63371: 62% mana brons_call_to_action(3)
1:45.289 aoe q arcane_explosion Fluffy_Pillow 35853.2/63371: 57% mana arcane_charge, brons_call_to_action(4)
1:46.594 aoe q arcane_explosion Fluffy_Pillow 32507.2/63371: 51% mana arcane_charge(2), brons_call_to_action(5)
1:47.899 aoe q arcane_explosion Fluffy_Pillow 29161.2/63371: 46% mana arcane_charge(3), brons_call_to_action(6)
1:49.206 aoe r arcane_barrage Fluffy_Pillow 25817.7/63371: 41% mana arcane_charge(4), brons_call_to_action(7)
1:50.512 aoe q arcane_explosion Fluffy_Pillow 30007.8/63371: 47% mana brons_call_to_action(8)
1:51.818 aoe q arcane_explosion Fluffy_Pillow 26663.1/63371: 42% mana arcane_charge, clearcasting, brons_call_to_action(9)
1:53.123 aoe q arcane_explosion Fluffy_Pillow 28317.1/63371: 45% mana arcane_charge(2), brons_call_to_action(10)
1:54.430 aoe q arcane_explosion Fluffy_Pillow 24973.6/63371: 39% mana arcane_charge(3), brons_call_to_action(11)
1:55.734 aoe r arcane_barrage Fluffy_Pillow 21626.4/63371: 34% mana arcane_charge(4), brons_call_to_action(12)
1:57.041 aoe m touch_of_the_magi Fluffy_Pillow 25817.7/63371: 41% mana brons_call_to_action(13)
1:58.346 aoe o rune_of_power Fluffy_Pillow 24971.7/63371: 39% mana arcane_charge(4), brons_call_to_action(14)
1:59.652 aoe r arcane_barrage Fluffy_Pillow 26627.0/63371: 42% mana arcane_charge(4), rune_of_power, brons_call_to_action(15)
2:00.960 aoe p arcane_orb Fluffy_Pillow 30819.6/63371: 49% mana rune_of_power, brons_call_to_action(16)
2:02.266 aoe r arcane_barrage Fluffy_Pillow 31974.9/63371: 50% mana arcane_charge(4), rune_of_power, brons_call_to_action(17)
2:03.574 aoe q arcane_explosion Fluffy_Pillow 36167.6/63371: 57% mana rune_of_power, brons_call_to_action(18)
2:04.880 aoe q arcane_explosion Fluffy_Pillow 32822.8/63371: 52% mana arcane_charge, rune_of_power, brons_call_to_action(19)
2:06.186 aoe q arcane_explosion Fluffy_Pillow 29478.1/63371: 47% mana arcane_charge(2), rune_of_power, brons_call_to_action(20)
2:07.490 aoe q arcane_explosion Fluffy_Pillow 26130.8/63371: 41% mana arcane_charge(3), rune_of_power, brons_call_to_action(21)
2:08.796 aoe r arcane_barrage Fluffy_Pillow 22786.1/63371: 36% mana arcane_charge(4), clearcasting, rune_of_power, brons_call_to_action(22)
2:10.101 aoe q arcane_explosion Fluffy_Pillow 26974.9/63371: 43% mana clearcasting, rune_of_power, brons_call_to_action(23)
2:11.407 aoe q arcane_explosion Fluffy_Pillow 28630.2/63371: 45% mana arcane_charge, rune_of_power, brons_call_to_action(24)
2:12.713 aoe q arcane_explosion Fluffy_Pillow 25285.5/63371: 40% mana arcane_charge(2), clearcasting, rune_of_power, brons_call_to_action(25)
2:14.019 aoe q arcane_explosion Fluffy_Pillow 26940.7/63371: 43% mana arcane_charge(3), rune_of_power, brons_call_to_action(26)
2:15.326 aoe l radiant_spark Fluffy_Pillow 23597.2/63371: 37% mana arcane_charge(4), brons_call_to_action(27)
2:16.631 aoe n arcane_power Fluffy_Pillow 24251.2/63371: 38% mana arcane_charge(4), brons_call_to_action(28)
2:16.631 aoe r arcane_barrage Fluffy_Pillow 24251.2/63371: 38% mana arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(29)
2:17.938 aoe q arcane_explosion Fluffy_Pillow 28442.6/63371: 45% mana arcane_power, rune_of_power, brons_call_to_action(30)
2:19.245 aoe q arcane_explosion Fluffy_Pillow 27599.2/63371: 44% mana arcane_charge, arcane_power, rune_of_power, brons_call_to_action(31)
2:20.552 aoe q arcane_explosion Fluffy_Pillow 26755.7/63371: 42% mana arcane_charge(2), arcane_power, rune_of_power, brons_call_to_action(32)
2:21.858 aoe q arcane_explosion Fluffy_Pillow 25910.9/63371: 41% mana arcane_charge(3), arcane_power, rune_of_power, brons_call_to_action(33)
2:23.165 aoe r arcane_barrage Fluffy_Pillow 25067.5/63371: 40% mana arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(34)
2:24.471 shared_cds t use_mana_gem Kyrian_Forgelite 29257.6/63371: 46% mana arcane_power, rune_of_power, brons_call_to_action(35)
2:24.471 aoe p arcane_orb Fluffy_Pillow 35594.7/63371: 56% mana arcane_power, rune_of_power, brons_call_to_action(35)
2:25.778 aoe r arcane_barrage Fluffy_Pillow 37001.3/63371: 58% mana arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(36)
2:27.085 aoe q arcane_explosion Fluffy_Pillow 41192.6/63371: 65% mana arcane_power, rune_of_power, brons_call_to_action(37)
2:28.393 aoe q arcane_explosion Fluffy_Pillow 40350.4/63371: 64% mana arcane_charge, arcane_power, rune_of_power, brons_call_to_action(38)
2:29.701 aoe q arcane_explosion Fluffy_Pillow 39508.2/63371: 62% mana arcane_charge(2), arcane_power, rune_of_power, brons_call_to_action(39)
2:31.008 aoe q arcane_explosion Fluffy_Pillow 38664.8/63371: 61% mana arcane_charge(3), arcane_power, rune_of_power, brons_call_to_action(40)
2:32.315 aoe r arcane_barrage Fluffy_Pillow 37821.3/63371: 60% mana arcane_charge(4), brons_call_to_action(41)
2:33.620 aoe q arcane_explosion Fluffy_Pillow 42010.2/63371: 66% mana brons_call_to_action(42)
2:34.927 aoe q arcane_explosion Fluffy_Pillow 38666.7/63371: 61% mana arcane_charge, brons_call_to_action(43)
2:36.232 aoe q arcane_explosion Fluffy_Pillow 35320.7/63371: 56% mana arcane_charge(2), brons_call_to_action(44)
2:37.539 aoe q arcane_explosion Fluffy_Pillow 31977.2/63371: 50% mana arcane_charge(3), brons_call_to_action(45)
2:38.846 aoe r arcane_barrage Fluffy_Pillow 28633.7/63371: 45% mana arcane_charge(4), brons_call_to_action(46)
2:40.153 aoe q arcane_explosion Fluffy_Pillow 32825.1/63371: 52% mana brons_call_to_action(47)
2:41.459 aoe q arcane_explosion Fluffy_Pillow 29480.4/63371: 47% mana arcane_charge, brons_call_to_action(48)
2:42.767 aoe q arcane_explosion Fluffy_Pillow 26138.2/63371: 41% mana arcane_charge(2), clearcasting, brons_call_to_action(49)
2:44.072 aoe q arcane_explosion Fluffy_Pillow 27792.2/63371: 44% mana arcane_charge(3), brons_call_to_action(50)
2:45.379 aoe r arcane_barrage Fluffy_Pillow 24448.7/63371: 39% mana arcane_charge(4), clearcasting, brons_call_to_action(51)
2:46.685 aoe k radiant_spark Fluffy_Pillow 28638.8/63371: 45% mana clearcasting, brons_call_to_action(52)
2:47.993 aoe m touch_of_the_magi Fluffy_Pillow 29296.6/63371: 46% mana clearcasting, brons_call_to_action(53)
2:49.299 aoe o rune_of_power Fluffy_Pillow 28451.9/63371: 45% mana arcane_charge(4), clearcasting, brons_call_to_action(54)
2:50.603 aoe r arcane_barrage Fluffy_Pillow 30104.6/63371: 48% mana arcane_charge(4), clearcasting, rune_of_power, brons_call_to_action(55)
2:51.910 aoe p arcane_orb Fluffy_Pillow 34296.0/63371: 54% mana clearcasting, rune_of_power, brons_call_to_action(56)
2:53.216 aoe r arcane_barrage Fluffy_Pillow 35451.3/63371: 56% mana arcane_charge(4), clearcasting, rune_of_power, brons_call_to_action(57)
2:54.524 aoe q arcane_explosion Fluffy_Pillow 39643.9/63371: 63% mana clearcasting, rune_of_power, brons_call_to_action(58)
2:55.830 aoe q arcane_explosion Fluffy_Pillow 41299.2/63371: 65% mana arcane_charge, rune_of_power, brons_call_to_action(59)
2:57.136 aoe q arcane_explosion Fluffy_Pillow 37954.4/63371: 60% mana arcane_charge(2), clearcasting, rune_of_power, brons_call_to_action(60)
2:58.442 aoe q arcane_explosion Fluffy_Pillow 39609.7/63371: 63% mana arcane_charge(3), rune_of_power, brons_call_to_action(61)
2:59.749 aoe r arcane_barrage Fluffy_Pillow 36266.2/63371: 57% mana arcane_charge(4), rune_of_power, brons_call_to_action(62)
3:01.056 aoe q arcane_explosion Fluffy_Pillow 40457.6/63371: 64% mana rune_of_power, brons_call_to_action(63)
3:02.362 aoe q arcane_explosion Fluffy_Pillow 37112.9/63371: 59% mana arcane_charge, clearcasting, rune_of_power, brons_call_to_action(64)
3:03.668 aoe q arcane_explosion Fluffy_Pillow 38768.1/63371: 61% mana arcane_charge(2), rune_of_power, brons_call_to_action(65)
3:04.973 aoe q arcane_explosion Fluffy_Pillow 35422.1/63371: 56% mana arcane_charge(3), rune_of_power, brons_call_to_action(66)
3:06.278 aoe r arcane_barrage Fluffy_Pillow 32076.1/63371: 51% mana arcane_charge(4), brons_call_to_action(67)
3:07.586 aoe q arcane_explosion Fluffy_Pillow 36268.8/63371: 57% mana brons_call_to_action(68)
3:08.896 aoe q arcane_explosion Fluffy_Pillow 32929.1/63371: 52% mana arcane_charge, brons_call_to_action(69)
3:10.202 aoe q arcane_explosion Fluffy_Pillow 29584.4/63371: 47% mana arcane_charge(2), brons_call_to_action(70)
3:11.506 aoe q arcane_explosion Fluffy_Pillow 26237.1/63371: 41% mana arcane_charge(3), brons_call_to_action(71)
3:12.813 aoe r arcane_barrage Fluffy_Pillow 22893.6/63371: 36% mana arcane_charge(4), brons_call_to_action(72)
3:14.120 aoe p arcane_orb Fluffy_Pillow 27085.0/63371: 43% mana brons_call_to_action(73)
3:15.427 aoe r arcane_barrage Fluffy_Pillow 28241.5/63371: 45% mana arcane_charge(4), brons_call_to_action(74)
3:16.733 aoe q arcane_explosion Fluffy_Pillow 32431.7/63371: 51% mana brons_call_to_action(75)
3:18.040 aoe j radiant_spark Fluffy_Pillow 29088.2/63371: 46% mana arcane_charge, brons_call_to_action(76)
3:19.347 aoe q arcane_explosion Fluffy_Pillow 29744.7/63371: 47% mana arcane_charge, brons_call_to_action(77)
3:20.654 aoe q arcane_explosion Fluffy_Pillow 26401.2/63371: 42% mana arcane_charge(2), brons_call_to_action(78)
3:21.959 aoe q arcane_explosion Fluffy_Pillow 23055.2/63371: 36% mana arcane_charge(3), brons_call_to_action(79)
3:23.267 aoe r arcane_barrage Fluffy_Pillow 19713.0/63371: 31% mana arcane_charge(4), brons_call_to_action(80)
3:24.574 aoe q arcane_explosion Fluffy_Pillow 23904.4/63371: 38% mana brons_call_to_action(81)
3:25.879 aoe q arcane_explosion Fluffy_Pillow 20558.4/63371: 32% mana arcane_charge, brons_call_to_action(82)
3:27.185 aoe q arcane_explosion Fluffy_Pillow 17213.7/63371: 27% mana arcane_charge(2), brons_call_to_action(83)
3:28.491 aoe q arcane_explosion Fluffy_Pillow 13868.9/63371: 22% mana arcane_charge(3), clearcasting, brons_call_to_action(84)
3:29.796 aoe r arcane_barrage Fluffy_Pillow 15522.9/63371: 24% mana arcane_charge(4), brons_call_to_action(85)
3:31.102 aoe q arcane_explosion Fluffy_Pillow 19713.1/63371: 31% mana brons_call_to_action(86)
3:32.408 aoe q arcane_explosion Fluffy_Pillow 16368.3/63371: 26% mana arcane_charge, brons_call_to_action(87)
3:33.716 aoe q arcane_explosion Fluffy_Pillow 13026.1/63371: 21% mana arcane_charge(2), brons_call_to_action(88)
3:35.022 aoe q arcane_explosion Fluffy_Pillow 9681.4/63371: 15% mana arcane_charge(3), brons_call_to_action(89)
3:36.328 aoe r arcane_barrage Fluffy_Pillow 6336.6/63371: 10% mana arcane_charge(4)
3:37.635 aoe m touch_of_the_magi Fluffy_Pillow 10528.0/63371: 17% mana brons_call_to_action
3:38.942 aoe o rune_of_power Fluffy_Pillow 9684.5/63371: 15% mana arcane_charge(4), brons_call_to_action(2)
3:40.248 aoe r arcane_barrage Fluffy_Pillow 11339.8/63371: 18% mana arcane_charge(4), rune_of_power, brons_call_to_action(3)
3:41.556 aoe p arcane_orb Fluffy_Pillow 15532.5/63371: 25% mana rune_of_power, brons_call_to_action(4)
3:42.862 aoe r arcane_barrage Fluffy_Pillow 16687.7/63371: 26% mana arcane_charge(4), clearcasting, rune_of_power, brons_call_to_action(5)
3:44.170 aoe q arcane_explosion Fluffy_Pillow 20880.4/63371: 33% mana clearcasting, rune_of_power, brons_call_to_action(6)
3:45.476 aoe q arcane_explosion Fluffy_Pillow 22535.6/63371: 36% mana arcane_charge, rune_of_power, brons_call_to_action(7)
3:46.783 aoe q arcane_explosion Fluffy_Pillow 19192.2/63371: 30% mana arcane_charge(2), clearcasting, rune_of_power, brons_call_to_action(8)
3:48.091 aoe q arcane_explosion Fluffy_Pillow 20850.0/63371: 33% mana arcane_charge(3), rune_of_power, brons_call_to_action(9)
3:49.398 aoe r arcane_barrage Fluffy_Pillow 17506.5/63371: 28% mana arcane_charge(4), rune_of_power, brons_call_to_action(10)
3:50.706 aoe j radiant_spark Fluffy_Pillow 21699.2/63371: 34% mana rune_of_power, brons_call_to_action(11)
3:52.014 aoe q arcane_explosion Fluffy_Pillow 22356.9/63371: 35% mana rune_of_power, brons_call_to_action(12)
3:53.321 aoe q arcane_explosion Fluffy_Pillow 19013.5/63371: 30% mana arcane_charge, rune_of_power, brons_call_to_action(13)
3:54.628 aoe q arcane_explosion Fluffy_Pillow 15670.0/63371: 25% mana arcane_charge(2), rune_of_power, brons_call_to_action(14)
3:55.935 aoe q arcane_explosion Fluffy_Pillow 12326.5/63371: 19% mana arcane_charge(3), brons_call_to_action(15)
3:57.242 aoe r arcane_barrage Fluffy_Pillow 8983.1/63371: 14% mana arcane_charge(4), brons_call_to_action(16)
3:58.548 aoe q arcane_explosion Fluffy_Pillow 13173.2/63371: 21% mana brons_call_to_action(17)
3:59.852 aoe q arcane_explosion Fluffy_Pillow 9825.9/63371: 16% mana arcane_charge, brons_call_to_action(18)
4:01.157 aoe q arcane_explosion Fluffy_Pillow 6479.9/63371: 10% mana arcane_charge(2), brons_call_to_action(19)
4:02.465 aoe s evocation Kyrian_Forgelite 3137.7/63371: 5% mana arcane_charge(3), brons_call_to_action(20)
4:06.809 aoe q arcane_explosion Fluffy_Pillow 56982.4/63371: 90% mana arcane_charge(3), brons_call_to_action(20)
4:08.116 aoe r arcane_barrage Fluffy_Pillow 53638.9/63371: 85% mana arcane_charge(4), brons_call_to_action(21)
4:09.424 aoe p arcane_orb Fluffy_Pillow 57831.6/63371: 91% mana brons_call_to_action(22)
4:10.730 aoe r arcane_barrage Fluffy_Pillow 58986.8/63371: 93% mana arcane_charge(4), brons_call_to_action(23)
4:12.037 aoe q arcane_explosion Fluffy_Pillow 63178.2/63371: 100% mana brons_call_to_action(24)
4:13.345 aoe q arcane_explosion Fluffy_Pillow 59836.0/63371: 94% mana arcane_charge, brons_call_to_action(25)
4:14.653 aoe q arcane_explosion Fluffy_Pillow 56493.8/63371: 89% mana arcane_charge(2), clearcasting, brons_call_to_action(26)
4:15.959 aoe q arcane_explosion Fluffy_Pillow 58149.1/63371: 92% mana arcane_charge(3), brons_call_to_action(27)
4:17.266 aoe r arcane_barrage Fluffy_Pillow 54805.6/63371: 86% mana arcane_charge(4), brons_call_to_action(28)
4:18.573 aoe q arcane_explosion Fluffy_Pillow 58997.0/63371: 93% mana brons_call_to_action(29)
4:19.878 aoe q arcane_explosion Fluffy_Pillow 55651.0/63371: 88% mana arcane_charge, brons_call_to_action(30)
4:21.185 aoe q arcane_explosion Fluffy_Pillow 52307.5/63371: 83% mana arcane_charge(2), brons_call_to_action(31)
4:22.491 aoe q arcane_explosion Fluffy_Pillow 48962.8/63371: 77% mana arcane_charge(3), brons_call_to_action(32)
4:23.796 aoe r arcane_barrage Fluffy_Pillow 45616.7/63371: 72% mana arcane_charge(4), brons_call_to_action(33)
4:25.102 shared_cds t use_mana_gem Kyrian_Forgelite 49806.9/63371: 79% mana brons_call_to_action(34)
4:25.102 aoe k radiant_spark Fluffy_Pillow 56144.0/63371: 89% mana brons_call_to_action(34)
4:26.410 aoe m touch_of_the_magi Fluffy_Pillow 56801.8/63371: 90% mana brons_call_to_action(35)
4:27.716 aoe n arcane_power Fluffy_Pillow 55957.1/63371: 88% mana arcane_charge(4), brons_call_to_action(36)
4:27.716 shared_cds v berserking Fluffy_Pillow 55957.1/63371: 88% mana arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(37)
4:27.716 aoe r arcane_barrage Fluffy_Pillow 55957.1/63371: 88% mana berserking, arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(38)
4:28.905 aoe q arcane_explosion Fluffy_Pillow 59998.9/63371: 95% mana berserking, arcane_power, rune_of_power, brons_call_to_action(39)
4:30.094 aoe q arcane_explosion Fluffy_Pillow 59005.9/63371: 93% mana berserking, arcane_charge, arcane_power, rune_of_power, brons_call_to_action(40)
4:31.282 aoe q arcane_explosion Fluffy_Pillow 58011.6/63371: 92% mana berserking, arcane_charge(2), arcane_power, rune_of_power, brons_call_to_action(41)
4:32.471 aoe q arcane_explosion Fluffy_Pillow 57018.5/63371: 90% mana berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power, brons_call_to_action(42)
4:33.661 aoe r arcane_barrage Fluffy_Pillow 58526.8/63371: 92% mana berserking, arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(43)
4:34.848 aoe p arcane_orb Fluffy_Pillow 62566.1/63371: 99% mana berserking, arcane_power, rune_of_power, brons_call_to_action(44)
4:36.034 aoe r arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana berserking, arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(45)
4:37.223 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana berserking, arcane_power, rune_of_power, brons_call_to_action(46)
4:38.411 aoe q arcane_explosion Fluffy_Pillow 62377.1/63371: 98% mana berserking, arcane_charge, arcane_power, rune_of_power, brons_call_to_action(47)
4:39.597 aoe q arcane_explosion Fluffy_Pillow 61380.3/63371: 97% mana berserking, arcane_charge(2), arcane_power, rune_of_power, brons_call_to_action(48)
4:40.785 aoe q arcane_explosion Fluffy_Pillow 60386.0/63371: 95% mana arcane_charge(3), arcane_power, rune_of_power, brons_call_to_action(49)
4:42.092 aoe r arcane_barrage Fluffy_Pillow 59542.5/63371: 94% mana arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(50)
4:43.399 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana brons_call_to_action(51)
4:44.704 aoe q arcane_explosion Fluffy_Pillow 60025.4/63371: 95% mana arcane_charge, brons_call_to_action(52)
4:46.011 aoe q arcane_explosion Fluffy_Pillow 56682.0/63371: 89% mana arcane_charge(2), brons_call_to_action(53)
4:47.317 aoe q arcane_explosion Fluffy_Pillow 53337.2/63371: 84% mana arcane_charge(3), brons_call_to_action(54)
4:48.623 aoe o rune_of_power Fluffy_Pillow 49992.5/63371: 79% mana arcane_charge(4), clearcasting, brons_call_to_action(55)
4:49.929 aoe r arcane_barrage Fluffy_Pillow 51647.7/63371: 82% mana arcane_charge(4), clearcasting, rune_of_power, brons_call_to_action(56)
4:51.235 aoe q arcane_explosion Fluffy_Pillow 55837.9/63371: 88% mana clearcasting, rune_of_power, brons_call_to_action(57)
4:52.540 aoe q arcane_explosion Fluffy_Pillow 57491.9/63371: 91% mana arcane_charge, rune_of_power, brons_call_to_action(58)
4:53.845 aoe q arcane_explosion Fluffy_Pillow 54145.8/63371: 85% mana arcane_charge(2), clearcasting, rune_of_power, brons_call_to_action(59)
4:55.152 aoe q arcane_explosion Fluffy_Pillow 55802.4/63371: 88% mana arcane_charge(3), rune_of_power, brons_call_to_action(60)
4:56.458 aoe r arcane_barrage Fluffy_Pillow 52457.6/63371: 83% mana arcane_charge(4), rune_of_power, brons_call_to_action(61)
4:57.766 aoe j radiant_spark Fluffy_Pillow 56650.3/63371: 89% mana rune_of_power, brons_call_to_action(62)
4:59.073 aoe p arcane_orb Fluffy_Pillow 57306.8/63371: 90% mana rune_of_power, brons_call_to_action(63)
5:00.379 aoe r arcane_barrage Fluffy_Pillow 58462.1/63371: 92% mana arcane_charge(4), rune_of_power, brons_call_to_action(64)
5:01.686 aoe q arcane_explosion Fluffy_Pillow 62653.5/63371: 99% mana rune_of_power, brons_call_to_action(65)
5:02.994 aoe q arcane_explosion Fluffy_Pillow 59311.3/63371: 94% mana arcane_charge, rune_of_power, brons_call_to_action(66)
5:04.299 aoe q arcane_explosion Fluffy_Pillow 55965.3/63371: 88% mana arcane_charge(2), clearcasting, rune_of_power, brons_call_to_action(67)
5:05.604 aoe q arcane_explosion Fluffy_Pillow 57619.3/63371: 91% mana arcane_charge(3), brons_call_to_action(68)
5:06.911 aoe r arcane_barrage Fluffy_Pillow 54275.8/63371: 86% mana arcane_charge(4), brons_call_to_action(69)
5:08.219 aoe q arcane_explosion Fluffy_Pillow 58468.4/63371: 92% mana brons_call_to_action(70)
5:09.525 aoe q arcane_explosion Fluffy_Pillow 55123.7/63371: 87% mana arcane_charge, brons_call_to_action(71)
5:10.831 aoe q arcane_explosion Fluffy_Pillow 51779.0/63371: 82% mana arcane_charge(2), clearcasting, brons_call_to_action(72)
5:12.136 aoe q arcane_explosion Fluffy_Pillow 53433.0/63371: 84% mana arcane_charge(3), brons_call_to_action(73)
5:13.442 aoe r arcane_barrage Fluffy_Pillow 50088.2/63371: 79% mana arcane_charge(4), brons_call_to_action(74)
5:14.748 aoe q arcane_explosion Fluffy_Pillow 54278.3/63371: 86% mana brons_call_to_action(75)
5:16.057 aoe q arcane_explosion Fluffy_Pillow 50937.4/63371: 80% mana arcane_charge, brons_call_to_action(76)
5:17.364 aoe q arcane_explosion Fluffy_Pillow 47593.9/63371: 75% mana arcane_charge(2), clearcasting, brons_call_to_action(77)
5:18.670 aoe q arcane_explosion Fluffy_Pillow 49249.2/63371: 78% mana arcane_charge(3), brons_call_to_action(78)
5:19.977 aoe r arcane_barrage Fluffy_Pillow 45905.7/63371: 72% mana arcane_charge(4), brons_call_to_action(79)
5:21.282 aoe p arcane_orb Fluffy_Pillow 50094.6/63371: 79% mana brons_call_to_action(80)
5:22.587 aoe r arcane_barrage Fluffy_Pillow 51248.6/63371: 81% mana arcane_charge(4), brons_call_to_action(81)
5:23.895 aoe q arcane_explosion Fluffy_Pillow 55441.2/63371: 87% mana brons_call_to_action(82)
5:25.202 aoe q arcane_explosion Fluffy_Pillow 52097.7/63371: 82% mana arcane_charge, brons_call_to_action(83)
5:26.509 aoe q arcane_explosion Fluffy_Pillow 48754.3/63371: 77% mana arcane_charge(2), clearcasting, brons_call_to_action(84)
5:27.817 aoe q arcane_explosion Fluffy_Pillow 50412.1/63371: 80% mana arcane_charge(3), brons_call_to_action(85)
5:29.124 aoe r arcane_barrage Fluffy_Pillow 47068.6/63371: 74% mana arcane_charge(4), clearcasting, brons_call_to_action(86)
5:30.431 aoe q arcane_explosion Fluffy_Pillow 51260.0/63371: 81% mana clearcasting, brons_call_to_action(87)
5:31.738 aoe q arcane_explosion Fluffy_Pillow 52916.5/63371: 84% mana arcane_charge, brons_call_to_action(88)
5:33.045 aoe q arcane_explosion Fluffy_Pillow 49573.0/63371: 78% mana arcane_charge(2), brons_call_to_action(89)
5:34.351 aoe q arcane_explosion Fluffy_Pillow 46228.3/63371: 73% mana arcane_charge(3)
5:35.657 aoe r arcane_barrage Fluffy_Pillow 42883.6/63371: 68% mana arcane_charge(4), clearcasting, brons_call_to_action
5:36.963 aoe k radiant_spark Fluffy_Pillow 47073.7/63371: 74% mana clearcasting, brons_call_to_action(2)
5:38.272 aoe m touch_of_the_magi Fluffy_Pillow 47732.8/63371: 75% mana clearcasting, brons_call_to_action(3)
5:39.579 aoe o rune_of_power Fluffy_Pillow 46889.3/63371: 74% mana arcane_charge(4), clearcasting, brons_call_to_action(4)
5:40.886 aoe r arcane_barrage Fluffy_Pillow 48545.8/63371: 77% mana arcane_charge(4), clearcasting, rune_of_power, brons_call_to_action(5)
5:42.192 aoe p arcane_orb Fluffy_Pillow 52735.9/63371: 83% mana clearcasting, rune_of_power, brons_call_to_action(6)
5:43.499 aoe r arcane_barrage Fluffy_Pillow 53892.5/63371: 85% mana arcane_charge(4), clearcasting, rune_of_power, brons_call_to_action(7)
5:44.804 aoe q arcane_explosion Fluffy_Pillow 58081.3/63371: 92% mana clearcasting, rune_of_power, brons_call_to_action(8)
5:46.110 aoe q arcane_explosion Fluffy_Pillow 59736.6/63371: 94% mana arcane_charge, rune_of_power, brons_call_to_action(9)
5:47.417 aoe q arcane_explosion Fluffy_Pillow 56393.1/63371: 89% mana arcane_charge(2), clearcasting, rune_of_power, brons_call_to_action(10)
5:48.725 aoe q arcane_explosion Fluffy_Pillow 58050.9/63371: 92% mana arcane_charge(3), rune_of_power, brons_call_to_action(11)
5:50.030 aoe r arcane_barrage Fluffy_Pillow 54704.9/63371: 86% mana arcane_charge(4), rune_of_power, brons_call_to_action(12)
5:51.338 aoe q arcane_explosion Fluffy_Pillow 58897.5/63371: 93% mana rune_of_power, brons_call_to_action(13)
5:52.644 aoe q arcane_explosion Fluffy_Pillow 55552.8/63371: 88% mana arcane_charge, rune_of_power, brons_call_to_action(14)
5:53.950 aoe q arcane_explosion Fluffy_Pillow 52208.1/63371: 82% mana arcane_charge(2), clearcasting, rune_of_power, brons_call_to_action(15)
5:55.259 aoe q arcane_explosion Fluffy_Pillow 53867.1/63371: 85% mana arcane_charge(3), rune_of_power, brons_call_to_action(16)
5:56.564 aoe r arcane_barrage Fluffy_Pillow 50521.1/63371: 80% mana arcane_charge(4), brons_call_to_action(17)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Kyrian_Forgelite"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=kyrian
soulbind=333950//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Kyrian_Pelagos : 10176 dps, 4331 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
10176.0 10176.0 11.8 / 0.116% 898.0 / 8.8% 5.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
1995.6 1902.8 Mana 0.00% 49.4 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_Pelagos 10176
Arcane Barrage 2800 27.5% 55.6 5.42sec 15174 12173 Direct 166.5 4247 8524 5066 19.1%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 55.58 166.50 0.00 0.00 1.2465 0.0000 843395.35 843395.35 0.00% 12173.37 12173.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.85% 134.62 99 171 4247.40 2082 13541 4244.95 3777 4576 571679 571679 0.00%
crit 19.15% 31.88 15 53 8523.93 4164 27082 8516.81 6274 12356 271717 271717 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [r]:55.58
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 372 3.7% 59.4 4.67sec 1885 0 Direct 178.3 527 1054 628 19.2%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 59.42 178.27 0.00 0.00 0.0000 0.0000 112011.00 112011.00 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.81% 144.06 107 187 527.42 316 664 526.85 483 572 75967 75967 0.00%
crit 19.19% 34.21 16 58 1053.58 633 1329 1052.21 925 1226 36044 36044 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 5057 49.7% 149.3 1.98sec 10195 8204 Direct 448.0 2848 5704 3399 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 149.33 448.00 0.00 0.00 1.2427 0.0000 1522500.61 1522500.61 0.00% 8204.32 8204.32
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 361.53 275 451 2847.62 2128 6597 2847.56 2741 2962 1029331 1029331 0.00%
crit 19.30% 86.46 45 131 5704.15 4256 13195 5704.67 5087 6438 493169 493169 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.546000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 54.6%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [q]:149.32
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (853) 0.0% (8.4%) 12.8 24.15sec 20051 16094

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.82 0.00 0.00 0.00 1.2459 0.0000 0.00 0.00 0.00% 16094.16 16094.16

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [p]:12.82
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 853 8.4% 38.4 24.15sec 6695 0 Direct 38.4 5615 11207 6695 19.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.39 38.39 0.00 0.00 0.0000 0.0000 256991.51 256991.51 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 30.97 20 43 5615.31 3869 9425 5613.71 4958 6192 173873 173873 0.00%
crit 19.32% 7.42 0 17 11206.89 7739 18850 11206.84 0 16251 83119 83119 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (69) 0.0% (0.7%) 14.7 1.77sec 1398 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.69 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 69 0.7% 14.7 1.77sec 1398 0 Direct 14.7 1164 2327 1397 20.2%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.69 14.69 0.00 0.00 0.0000 0.0000 20538.66 20538.66 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.84% 11.73 4 19 1163.53 1164 1164 1163.53 1164 1164 13646 13646 0.00%
crit 20.16% 2.96 0 9 2327.06 2327 2327 2206.35 0 2327 6893 6893 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1752 18.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1752.90 1752.90 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.62% 0.82 0 1 1480.68 1481 1481 1208.46 0 1481 1208 1208 0.00%
crit 18.38% 0.18 0 1 2961.35 2961 2961 544.44 0 2961 544 544 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (21) 0.0% (0.2%) 1.0 0.00sec 6096 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 152  / 21 0.2% 90.0 1.29sec 68 52 Direct 90.0 57 114 68 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6096.18 6096.18 0.00% 51.76 51.76
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 72.67 60 85 56.80 43 60 56.80 56 58 4128 4128 0.00%
crit 19.26% 17.33 5 30 113.56 86 120 113.57 99 120 1969 1969 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Radiant Spark 189 1.9% 9.3 33.78sec 6092 4783 Direct 9.3 3027 6081 3608 19.0%
Periodic 60.8 320 638 382 19.4% 10.2%

Stats Details: Radiant Spark

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.33 9.33 60.76 60.76 1.2737 1.5131 56858.15 56858.15 0.00% 547.65 4782.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.98% 7.56 3 11 3026.92 2693 5655 3028.82 2693 3703 22876 22876 0.00%
crit 19.02% 1.78 0 6 6080.77 5386 11310 5225.77 0 11310 10794 10794 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.62% 48.98 32 65 320.14 34 501 319.70 286 370 15677 15677 0.00%
crit 19.38% 11.78 3 24 637.68 68 1003 636.90 408 947 7512 7512 0.00%

Action Details: Radiant Spark

  • id:307443
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.760000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.082400
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:307443
  • name:Radiant Spark
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Conjure a radiant spark that causes {$s1=0 + 76.0%} Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes {$307454s1=10}% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells.

Action Priority List

    aoe
    [j]:4.56
  • if_expr:cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
    aoe
    [k]:3.81
  • if_expr:cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
    aoe
    [l]:1.00
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Touch of the Magi 0 (810) 0.0% (8.0%) 5.9 54.23sec 40955 32607

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.95 0.00 0.00 0.00 1.2560 0.0000 0.00 0.00 0.00% 32606.90 32606.90

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [m]:5.97
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 810 8.0% 5.9 54.11sec 40955 0 Direct 17.8 13676 0 13676 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.95 17.82 0.00 0.00 0.0000 0.0000 243606.18 243606.18 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 17.82 15 21 13676.07 109 48795 13672.49 10629 16889 243606 243606 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:29797.49
  • base_dd_max:29797.49
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Kyrian_Pelagos
Arcane Power 2.8 132.25sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.79 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [n]:2.80
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 264.32sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.79 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [v]:1.80
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.0 179.04sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 5.95 0.00 4.3061 0.7222 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [s]:1.00
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [u]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 5.8 52.72sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.78 0.00 0.00 0.00 1.2546 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [o]:5.81
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 124.86sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [t]:2.75
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 56.3 150.2 5.3sec 1.4sec 3.9sec 72.17% 0.00% 0.1 (0.2) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s

Stack Uptimes

  • arcane_charge_1:18.76%
  • arcane_charge_2:15.96%
  • arcane_charge_3:16.08%
  • arcane_charge_4:21.36%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 132.0sec 132.0sec 14.6sec 13.54% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.4s / 138.9s
  • trigger_min/max:120.4s / 138.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:13.54%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 263.8sec 263.8sec 11.6sec 6.85% 23.28% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:241.0s / 272.0s
  • trigger_min/max:241.0s / 272.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • berserking_1:6.85%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.46% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.46%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 23.8 0.2 12.2sec 12.1sec 2.1sec 16.25% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.03%
  • clearcasting_2:0.22%
  • clearcasting_3:0.01%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Combat Meditation 4.9 0.0 67.6sec 67.6sec 6.1sec 9.88% 0.00% 7.3 (7.3) 4.8

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_combat_meditation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:0.50
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Stat Details

  • stat:mastery_rating
  • amount:233.00

Trigger Details

  • interval_min/max:62.7s / 84.9s
  • trigger_min/max:62.7s / 84.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • combat_meditation_1:9.88%

Spelldata

  • id:328908
  • name:Combat Meditation
  • tooltip:Mastery increased by $w.
  • description:{$@spelldesc328266=$?a137005[Shackle the Unworthy]?a212611[Elysian Decree]?a137009[Kindred Spirits]?a137014[Resonating Arrow]?a137018[Radiant Spark]?a137022[Weapons of Order]?a137026[Divine Toll]?a137030[Boon of the Ascended]?a137034[Echoing Reprimand]?a137038[Vesper Totem]?a137042[Scouring Tithe]?a137047[Spear of Bastion][Activating your Kyrian class ability] increases your Mastery by $328908m1 for ${{$328908d=10 seconds}*$<mod>}.1 sec and occasionally expels Sorrowful Memories. Walking through Sorrowful Memories extends this effect by ${$328913m2*$<mod>}.1 sec. $?a137018|?a137034[Combat Meditation may only occur once every {$345861d=60 seconds}.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Evocation 1.0 0.0 176.7sec 176.7sec 4.3sec 1.43% 0.00% 4.0 (4.0) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:104.9s / 244.8s
  • trigger_min/max:104.9s / 244.8s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 4.3s

Stack Uptimes

  • evocation_1:1.43%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.41% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.41%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.6 0.0 36.6sec 36.6sec 14.6sec 41.71% 0.00% 0.0 (0.0) 8.2

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:16.8s / 55.3s
  • trigger_min/max:16.8s / 55.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:41.71%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.41% 0.82% 6.93% 0.9s 0.0s 5.2s
Conserve Phase 100.00% 100.00% 100.00% 301.2s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000181.223120.154239.984
Evocation172.90914.943336.584227.829141.837358.609
Rune of Power8.4511.13829.91551.21131.83869.013
Touch of the Magi6.8811.13831.22243.63630.53267.707
Arcane Power8.5440.37718.92724.4252.69534.284
Arcane Barrage2.9240.0029.588163.653128.991197.432
Arcane Orb4.0980.01511.79353.06540.26869.527
Radiant Spark2.2430.00025.19221.7559.69258.620

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_Pelagos
mana_regen Mana 629.70 372232.86 64.95% 591.13 11277.19 2.94%
Evocation Mana 47.61 47968.50 8.37% 1007.46 0.00 0.00%
Mana Gem Mana 2.75 17499.18 3.05% 6369.74 0.00 0.00%
Arcane Barrage Mana 55.58 135404.74 23.63% 2436.29 6651.11 4.68%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1902.84 1995.62 17897.1 34807.1 92.2 63371.4
Usage Type Count Total Avg RPE APR
Kyrian_Pelagos
arcane_explosion Mana 149.3 570108.8 3818.0 3817.7 2.7
arcane_orb Mana 12.8 5730.3 447.0 447.1 44.8
radiant_spark Mana 9.3 9233.3 988.7 989.3 6.2
touch_of_the_magi Mana 5.9 14871.7 2500.0 2500.2 16.4

Statistics & Data Analysis

Fight Length
Kyrian_Pelagos Fight Length
Count 1523
Mean 301.22
Minimum 240.15
Maximum 359.98
Spread ( max - min ) 119.83
Range [ ( max - min ) / 2 * 100% ] 19.89%
DPS
Kyrian_Pelagos Damage Per Second
Count 1523
Mean 10175.97
Minimum 9461.91
Maximum 10911.44
Spread ( max - min ) 1449.54
Range [ ( max - min ) / 2 * 100% ] 7.12%
Standard Deviation 235.1467
5th Percentile 9797.70
95th Percentile 10564.35
( 95th Percentile - 5th Percentile ) 766.66
Mean Distribution
Standard Deviation 6.0254
95.00% Confidence Interval ( 10164.16 - 10187.78 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2052
0.1 Scale Factor Error with Delta=300 473
0.05 Scale Factor Error with Delta=300 1889
0.01 Scale Factor Error with Delta=300 47203
Priority Target DPS
Kyrian_Pelagos Priority Target Damage Per Second
Count 1523
Mean 4331.30
Minimum 3901.86
Maximum 4762.33
Spread ( max - min ) 860.47
Range [ ( max - min ) / 2 * 100% ] 9.93%
Standard Deviation 133.8511
5th Percentile 4126.06
95th Percentile 4556.98
( 95th Percentile - 5th Percentile ) 430.92
Mean Distribution
Standard Deviation 3.4298
95.00% Confidence Interval ( 4324.58 - 4338.02 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3669
0.1 Scale Factor Error with Delta=300 153
0.05 Scale Factor Error with Delta=300 612
0.01 Scale Factor Error with Delta=300 15295
DPS(e)
Kyrian_Pelagos Damage Per Second (Effective)
Count 1523
Mean 10175.97
Minimum 9461.91
Maximum 10911.44
Spread ( max - min ) 1449.54
Range [ ( max - min ) / 2 * 100% ] 7.12%
Damage
Kyrian_Pelagos Damage
Count 1523
Mean 3057654.36
Minimum 2363057.44
Maximum 3745460.51
Spread ( max - min ) 1382403.07
Range [ ( max - min ) / 2 * 100% ] 22.61%
DTPS
Kyrian_Pelagos Damage Taken Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_Pelagos Healing Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_Pelagos Healing Per Second (Effective)
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_Pelagos Heal
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_Pelagos Healing Taken Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_Pelagos Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_PelagosTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_Pelagos Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
j 4.56 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
k 3.81 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
l 1.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
m 5.97 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
n 2.80 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
o 5.81 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
p 12.82 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
q 149.32 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
r 55.58 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
s 1.00 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
t 2.75 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
u 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
v 1.80 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYkmnuvrprqqqqrqqqqrqqqqorqqqqtrprqqqqrjqqqqrqqqqrqqqqrprqqqqrqqqqrkmorprqqqqrqqqqrqqqqrprqjqqqrqqqqrqqqqrmorprqqqqrqqqqlnrqqqqrtprqqqqrqqqqrqqqqrkmorprqqqqrqqqqrqqqqrprqjqqqrqqqqrqqqqrmorprqqqqrjqqqqrqqqqrprqqqqrqqqqrqskmnvrprqqqqrqqqqrqqqtqorprqqjqqrqqqqrqqqqrprqqqqrqqqqrqqqqrkmorprqqqqrqqqq

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Kyrian_Pelagos 63371.4/63371: 100% mana
Pre precombat R food Kyrian_Pelagos 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe k radiant_spark Fluffy_Pillow 62371.4/63371: 98% mana
0:01.306 aoe m touch_of_the_magi Fluffy_Pillow 66308.1/67366: 98% mana bloodlust, combat_meditation
0:02.313 aoe n arcane_power Fluffy_Pillow 64872.5/67366: 96% mana bloodlust, arcane_charge(4), combat_meditation
0:02.313 shared_cds u potion Fluffy_Pillow 64872.5/67366: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, combat_meditation
0:02.313 shared_cds v berserking Fluffy_Pillow 64872.5/67366: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:02.313 aoe r arcane_barrage Fluffy_Pillow 64872.5/67366: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:03.228 aoe p arcane_orb Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:04.142 aoe r arcane_barrage Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:05.058 aoe q arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:05.975 aoe q arcane_explosion Fluffy_Pillow 66101.2/67366: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:06.889 aoe q arcane_explosion Fluffy_Pillow 60988.6/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.803 aoe q arcane_explosion Fluffy_Pillow 59647.0/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.717 aoe r arcane_barrage Fluffy_Pillow 58305.4/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.633 aoe q arcane_explosion Fluffy_Pillow 62001.2/63371: 98% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.547 aoe q arcane_explosion Fluffy_Pillow 60659.7/63371: 96% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.460 aoe q arcane_explosion Fluffy_Pillow 59316.8/63371: 94% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.376 aoe q arcane_explosion Fluffy_Pillow 57977.8/63371: 91% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.292 aoe r arcane_barrage Fluffy_Pillow 56638.8/63371: 89% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.205 aoe q arcane_explosion Fluffy_Pillow 60330.8/63371: 95% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:15.121 aoe q arcane_explosion Fluffy_Pillow 58991.7/63371: 93% mana bloodlust, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:16.127 aoe q arcane_explosion Fluffy_Pillow 57766.8/63371: 91% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:17.135 aoe q arcane_explosion Fluffy_Pillow 56544.3/63371: 89% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:18.141 aoe o rune_of_power Fluffy_Pillow 55319.4/63371: 87% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:19.148 aoe r arcane_barrage Fluffy_Pillow 56595.7/63371: 89% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:20.155 aoe q arcane_explosion Fluffy_Pillow 60406.8/63371: 95% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:21.162 aoe q arcane_explosion Fluffy_Pillow 56683.1/63371: 89% mana bloodlust, arcane_charge, clearcasting, rune_of_power, potion_of_deathly_fixation
0:22.168 aoe q arcane_explosion Fluffy_Pillow 57958.2/63371: 91% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:23.173 aoe q arcane_explosion Fluffy_Pillow 54231.9/63371: 86% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:24.181 shared_cds t use_mana_gem Kyrian_Pelagos 50509.5/63371: 80% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:24.181 aoe r arcane_barrage Fluffy_Pillow 56846.6/63371: 90% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:25.188 aoe p arcane_orb Fluffy_Pillow 60657.8/63371: 96% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:26.193 aoe r arcane_barrage Fluffy_Pillow 61431.6/63371: 97% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:27.199 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:28.205 aoe q arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:29.212 aoe q arcane_explosion Fluffy_Pillow 55922.8/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power
0:30.219 aoe q arcane_explosion Fluffy_Pillow 52199.1/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power
0:31.226 aoe r arcane_barrage Fluffy_Pillow 48475.4/63371: 76% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power
0:32.233 aoe j radiant_spark Fluffy_Pillow 52286.5/63371: 83% mana bloodlust, clearcasting, rune_of_power
0:33.239 aoe q arcane_explosion Fluffy_Pillow 52561.6/63371: 83% mana bloodlust, clearcasting, rune_of_power
0:34.248 aoe q arcane_explosion Fluffy_Pillow 53840.4/63371: 85% mana bloodlust, arcane_charge
0:35.253 aoe q arcane_explosion Fluffy_Pillow 50114.2/63371: 79% mana bloodlust, arcane_charge(2)
0:36.260 aoe q arcane_explosion Fluffy_Pillow 46390.5/63371: 73% mana bloodlust, arcane_charge(3), clearcasting
0:37.267 aoe r arcane_barrage Fluffy_Pillow 47666.8/63371: 75% mana bloodlust, arcane_charge(4)
0:38.273 aoe q arcane_explosion Fluffy_Pillow 51476.6/63371: 81% mana bloodlust
0:39.277 aoe q arcane_explosion Fluffy_Pillow 47749.1/63371: 75% mana bloodlust, arcane_charge
0:40.283 aoe q arcane_explosion Fluffy_Pillow 44024.2/63371: 69% mana bloodlust, arcane_charge(2)
0:41.291 aoe q arcane_explosion Fluffy_Pillow 40301.7/63371: 64% mana arcane_charge(3), clearcasting
0:42.599 aoe r arcane_barrage Fluffy_Pillow 41959.5/63371: 66% mana arcane_charge(4)
0:43.906 aoe q arcane_explosion Fluffy_Pillow 46150.9/63371: 73% mana
0:45.212 aoe q arcane_explosion Fluffy_Pillow 42806.2/63371: 68% mana arcane_charge, clearcasting
0:46.518 aoe q arcane_explosion Fluffy_Pillow 44461.5/63371: 70% mana arcane_charge(2)
0:47.825 aoe q arcane_explosion Fluffy_Pillow 41118.0/63371: 65% mana arcane_charge(3)
0:49.130 aoe r arcane_barrage Fluffy_Pillow 37772.0/63371: 60% mana arcane_charge(4)
0:50.437 aoe p arcane_orb Fluffy_Pillow 41963.4/63371: 66% mana
0:51.744 aoe r arcane_barrage Fluffy_Pillow 43119.9/63371: 68% mana arcane_charge(4)
0:53.049 aoe q arcane_explosion Fluffy_Pillow 47308.7/63371: 75% mana
0:54.355 aoe q arcane_explosion Fluffy_Pillow 43964.0/63371: 69% mana arcane_charge
0:55.660 aoe q arcane_explosion Fluffy_Pillow 40618.0/63371: 64% mana arcane_charge(2)
0:56.968 aoe q arcane_explosion Fluffy_Pillow 37275.8/63371: 59% mana arcane_charge(3)
0:58.274 aoe r arcane_barrage Fluffy_Pillow 33931.1/63371: 54% mana arcane_charge(4)
0:59.581 aoe q arcane_explosion Fluffy_Pillow 38122.4/63371: 60% mana
1:00.887 aoe q arcane_explosion Fluffy_Pillow 34777.7/63371: 55% mana arcane_charge, clearcasting
1:02.194 aoe q arcane_explosion Fluffy_Pillow 36434.2/63371: 57% mana arcane_charge(2)
1:03.501 aoe q arcane_explosion Fluffy_Pillow 33090.8/63371: 52% mana arcane_charge(3), clearcasting
1:04.807 aoe r arcane_barrage Fluffy_Pillow 34746.0/63371: 55% mana arcane_charge(4)
1:06.113 aoe k radiant_spark Fluffy_Pillow 38936.1/63371: 61% mana
1:07.419 aoe m touch_of_the_magi Fluffy_Pillow 42086.8/67366: 62% mana combat_meditation
1:08.725 aoe o rune_of_power Fluffy_Pillow 41346.4/67366: 61% mana arcane_charge(4), combat_meditation
1:10.032 aoe r arcane_barrage Fluffy_Pillow 43107.4/67366: 64% mana arcane_charge(4), rune_of_power, combat_meditation
1:11.338 aoe p arcane_orb Fluffy_Pillow 47561.6/67366: 71% mana rune_of_power, combat_meditation
1:12.644 aoe r arcane_barrage Fluffy_Pillow 45926.5/63371: 72% mana arcane_charge(4), rune_of_power
1:13.950 aoe q arcane_explosion Fluffy_Pillow 50116.6/63371: 79% mana rune_of_power
1:15.257 aoe q arcane_explosion Fluffy_Pillow 46773.1/63371: 74% mana arcane_charge, clearcasting, rune_of_power
1:16.565 aoe q arcane_explosion Fluffy_Pillow 48430.9/63371: 76% mana arcane_charge(2), rune_of_power
1:17.871 aoe q arcane_explosion Fluffy_Pillow 45086.2/63371: 71% mana arcane_charge(3), rune_of_power
1:19.180 aoe r arcane_barrage Fluffy_Pillow 41745.2/63371: 66% mana arcane_charge(4), rune_of_power
1:20.488 aoe q arcane_explosion Fluffy_Pillow 45937.9/63371: 72% mana rune_of_power
1:21.794 aoe q arcane_explosion Fluffy_Pillow 42593.1/63371: 67% mana arcane_charge, rune_of_power
1:23.102 aoe q arcane_explosion Fluffy_Pillow 39250.9/63371: 62% mana arcane_charge(2), rune_of_power
1:24.408 aoe q arcane_explosion Fluffy_Pillow 35906.2/63371: 57% mana arcane_charge(3), rune_of_power
1:25.714 aoe r arcane_barrage Fluffy_Pillow 32561.5/63371: 51% mana arcane_charge(4)
1:27.020 aoe q arcane_explosion Fluffy_Pillow 36751.6/63371: 58% mana
1:28.328 aoe q arcane_explosion Fluffy_Pillow 33409.4/63371: 53% mana arcane_charge
1:29.635 aoe q arcane_explosion Fluffy_Pillow 30065.9/63371: 47% mana arcane_charge(2), clearcasting
1:30.940 aoe q arcane_explosion Fluffy_Pillow 31719.9/63371: 50% mana arcane_charge(3)
1:32.246 aoe r arcane_barrage Fluffy_Pillow 28375.2/63371: 45% mana arcane_charge(4)
1:33.552 aoe p arcane_orb Fluffy_Pillow 32565.3/63371: 51% mana
1:34.859 aoe r arcane_barrage Fluffy_Pillow 33721.8/63371: 53% mana arcane_charge(4)
1:36.164 aoe q arcane_explosion Fluffy_Pillow 37910.7/63371: 60% mana
1:37.469 aoe j radiant_spark Fluffy_Pillow 34564.7/63371: 55% mana arcane_charge
1:38.776 aoe q arcane_explosion Fluffy_Pillow 35221.2/63371: 56% mana arcane_charge
1:40.084 aoe q arcane_explosion Fluffy_Pillow 31879.0/63371: 50% mana arcane_charge(2)
1:41.389 aoe q arcane_explosion Fluffy_Pillow 28533.0/63371: 45% mana arcane_charge(3), clearcasting
1:42.695 aoe r arcane_barrage Fluffy_Pillow 30188.2/63371: 48% mana arcane_charge(4)
1:44.001 aoe q arcane_explosion Fluffy_Pillow 34378.4/63371: 54% mana
1:45.308 aoe q arcane_explosion Fluffy_Pillow 31034.9/63371: 49% mana arcane_charge, clearcasting
1:46.615 aoe q arcane_explosion Fluffy_Pillow 32691.4/63371: 52% mana arcane_charge(2)
1:47.920 aoe q arcane_explosion Fluffy_Pillow 29345.4/63371: 46% mana arcane_charge(3), clearcasting
1:49.226 aoe r arcane_barrage Fluffy_Pillow 31000.7/63371: 49% mana arcane_charge(4)
1:50.531 aoe q arcane_explosion Fluffy_Pillow 35189.5/63371: 56% mana
1:51.837 aoe q arcane_explosion Fluffy_Pillow 31844.8/63371: 50% mana arcane_charge
1:53.145 aoe q arcane_explosion Fluffy_Pillow 28502.6/63371: 45% mana arcane_charge(2)
1:54.452 aoe q arcane_explosion Fluffy_Pillow 25159.1/63371: 40% mana arcane_charge(3)
1:55.758 aoe r arcane_barrage Fluffy_Pillow 21814.4/63371: 34% mana arcane_charge(4)
1:57.064 aoe m touch_of_the_magi Fluffy_Pillow 26004.5/63371: 41% mana
1:58.372 aoe o rune_of_power Fluffy_Pillow 25162.3/63371: 40% mana arcane_charge(4)
1:59.679 aoe r arcane_barrage Fluffy_Pillow 26818.8/63371: 42% mana arcane_charge(4), rune_of_power
2:00.985 aoe p arcane_orb Fluffy_Pillow 31008.9/63371: 49% mana rune_of_power
2:02.291 aoe r arcane_barrage Fluffy_Pillow 32164.2/63371: 51% mana arcane_charge(4), rune_of_power
2:03.598 aoe q arcane_explosion Fluffy_Pillow 36355.6/63371: 57% mana rune_of_power
2:04.903 aoe q arcane_explosion Fluffy_Pillow 33009.6/63371: 52% mana arcane_charge, rune_of_power
2:06.208 aoe q arcane_explosion Fluffy_Pillow 29663.6/63371: 47% mana arcane_charge(2), rune_of_power
2:07.513 aoe q arcane_explosion Fluffy_Pillow 26317.6/63371: 42% mana arcane_charge(3), rune_of_power
2:08.821 aoe r arcane_barrage Fluffy_Pillow 22975.4/63371: 36% mana arcane_charge(4), rune_of_power
2:10.127 aoe q arcane_explosion Fluffy_Pillow 27165.5/63371: 43% mana rune_of_power
2:11.433 aoe q arcane_explosion Fluffy_Pillow 23820.7/63371: 38% mana arcane_charge, clearcasting, rune_of_power
2:12.740 aoe q arcane_explosion Fluffy_Pillow 25477.3/63371: 40% mana arcane_charge(2), rune_of_power
2:14.048 aoe q arcane_explosion Fluffy_Pillow 22135.1/63371: 35% mana arcane_charge(3), clearcasting, rune_of_power
2:15.356 aoe l radiant_spark Fluffy_Pillow 23792.9/63371: 38% mana arcane_charge(4)
2:16.663 aoe n arcane_power Fluffy_Pillow 25990.4/67366: 39% mana arcane_charge(4), combat_meditation
2:16.663 aoe r arcane_barrage Fluffy_Pillow 25990.4/67366: 39% mana arcane_charge(4), arcane_power, rune_of_power, combat_meditation
2:17.968 aoe q arcane_explosion Fluffy_Pillow 30443.3/67366: 45% mana arcane_power, rune_of_power, combat_meditation
2:19.273 aoe q arcane_explosion Fluffy_Pillow 29701.6/67366: 44% mana arcane_charge, arcane_power, rune_of_power, combat_meditation
2:20.580 aoe q arcane_explosion Fluffy_Pillow 28962.5/67366: 43% mana arcane_charge(2), arcane_power, rune_of_power, combat_meditation
2:21.886 aoe q arcane_explosion Fluffy_Pillow 26548.7/63371: 42% mana arcane_charge(3), arcane_power, rune_of_power
2:23.192 aoe r arcane_barrage Fluffy_Pillow 25704.0/63371: 41% mana arcane_charge(4), arcane_power, rune_of_power
2:24.500 shared_cds t use_mana_gem Kyrian_Pelagos 29896.6/63371: 47% mana arcane_power, rune_of_power
2:24.500 aoe p arcane_orb Fluffy_Pillow 36233.8/63371: 57% mana arcane_power, rune_of_power
2:25.807 aoe r arcane_barrage Fluffy_Pillow 37640.3/63371: 59% mana arcane_charge(4), arcane_power, rune_of_power
2:27.113 aoe q arcane_explosion Fluffy_Pillow 41830.4/63371: 66% mana arcane_power, rune_of_power
2:28.420 aoe q arcane_explosion Fluffy_Pillow 40987.0/63371: 65% mana arcane_charge, arcane_power, rune_of_power
2:29.726 aoe q arcane_explosion Fluffy_Pillow 40142.2/63371: 63% mana arcane_charge(2), arcane_power, rune_of_power
2:31.034 aoe q arcane_explosion Fluffy_Pillow 39300.0/63371: 62% mana arcane_charge(3), arcane_power, rune_of_power
2:32.339 aoe r arcane_barrage Fluffy_Pillow 38454.0/63371: 61% mana arcane_charge(4)
2:33.647 aoe q arcane_explosion Fluffy_Pillow 42646.7/63371: 67% mana
2:34.952 aoe q arcane_explosion Fluffy_Pillow 39300.7/63371: 62% mana arcane_charge
2:36.256 aoe q arcane_explosion Fluffy_Pillow 35953.4/63371: 57% mana arcane_charge(2), clearcasting
2:37.564 aoe q arcane_explosion Fluffy_Pillow 37611.2/63371: 59% mana arcane_charge(3)
2:38.871 aoe r arcane_barrage Fluffy_Pillow 34267.7/63371: 54% mana arcane_charge(4)
2:40.176 aoe q arcane_explosion Fluffy_Pillow 38456.6/63371: 61% mana
2:41.484 aoe q arcane_explosion Fluffy_Pillow 35114.4/63371: 55% mana arcane_charge
2:42.791 aoe q arcane_explosion Fluffy_Pillow 31770.9/63371: 50% mana arcane_charge(2)
2:44.099 aoe q arcane_explosion Fluffy_Pillow 28428.7/63371: 45% mana arcane_charge(3)
2:45.405 aoe r arcane_barrage Fluffy_Pillow 25083.9/63371: 40% mana arcane_charge(4)
2:46.711 aoe k radiant_spark Fluffy_Pillow 29274.1/63371: 46% mana
2:48.017 aoe m touch_of_the_magi Fluffy_Pillow 29929.3/63371: 47% mana
2:49.323 aoe o rune_of_power Fluffy_Pillow 29084.6/63371: 46% mana arcane_charge(4), clearcasting
2:50.629 aoe r arcane_barrage Fluffy_Pillow 30739.9/63371: 49% mana arcane_charge(4), clearcasting, rune_of_power
2:51.935 aoe p arcane_orb Fluffy_Pillow 34930.0/63371: 55% mana clearcasting, rune_of_power
2:53.242 aoe r arcane_barrage Fluffy_Pillow 36086.5/63371: 57% mana arcane_charge(4), clearcasting, rune_of_power
2:54.549 aoe q arcane_explosion Fluffy_Pillow 40277.9/63371: 64% mana clearcasting, rune_of_power
2:55.856 aoe q arcane_explosion Fluffy_Pillow 41934.4/63371: 66% mana arcane_charge, rune_of_power
2:57.162 aoe q arcane_explosion Fluffy_Pillow 38589.7/63371: 61% mana arcane_charge(2), rune_of_power
2:58.470 aoe q arcane_explosion Fluffy_Pillow 35247.5/63371: 56% mana arcane_charge(3), rune_of_power
2:59.775 aoe r arcane_barrage Fluffy_Pillow 31901.5/63371: 50% mana arcane_charge(4), rune_of_power
3:01.082 aoe q arcane_explosion Fluffy_Pillow 36092.9/63371: 57% mana rune_of_power
3:02.389 aoe q arcane_explosion Fluffy_Pillow 32749.4/63371: 52% mana arcane_charge, rune_of_power
3:03.695 aoe q arcane_explosion Fluffy_Pillow 29404.6/63371: 46% mana arcane_charge(2), rune_of_power
3:05.001 aoe q arcane_explosion Fluffy_Pillow 26059.9/63371: 41% mana arcane_charge(3), rune_of_power
3:06.307 aoe r arcane_barrage Fluffy_Pillow 22715.2/63371: 36% mana arcane_charge(4), clearcasting
3:07.614 aoe q arcane_explosion Fluffy_Pillow 26906.6/63371: 42% mana clearcasting
3:08.921 aoe q arcane_explosion Fluffy_Pillow 28563.1/63371: 45% mana arcane_charge
3:10.227 aoe q arcane_explosion Fluffy_Pillow 25218.3/63371: 40% mana arcane_charge(2)
3:11.534 aoe q arcane_explosion Fluffy_Pillow 21874.9/63371: 35% mana arcane_charge(3)
3:12.839 aoe r arcane_barrage Fluffy_Pillow 18528.9/63371: 29% mana arcane_charge(4), clearcasting
3:14.147 aoe p arcane_orb Fluffy_Pillow 22721.5/63371: 36% mana clearcasting
3:15.454 aoe r arcane_barrage Fluffy_Pillow 23878.1/63371: 38% mana arcane_charge(4), clearcasting
3:16.762 aoe q arcane_explosion Fluffy_Pillow 28070.7/63371: 44% mana clearcasting
3:18.069 aoe j radiant_spark Fluffy_Pillow 29727.2/63371: 47% mana arcane_charge
3:19.376 aoe q arcane_explosion Fluffy_Pillow 32298.8/67366: 48% mana arcane_charge, combat_meditation
3:20.684 aoe q arcane_explosion Fluffy_Pillow 29061.1/67366: 43% mana arcane_charge(2), combat_meditation
3:21.992 aoe q arcane_explosion Fluffy_Pillow 25823.4/67366: 38% mana arcane_charge(3), combat_meditation
3:23.300 aoe r arcane_barrage Fluffy_Pillow 22585.7/67366: 34% mana arcane_charge(4), combat_meditation
3:24.607 aoe q arcane_explosion Fluffy_Pillow 27041.3/67366: 40% mana combat_meditation
3:25.914 aoe q arcane_explosion Fluffy_Pillow 22390.9/63371: 35% mana arcane_charge
3:27.222 aoe q arcane_explosion Fluffy_Pillow 19048.7/63371: 30% mana arcane_charge(2)
3:28.529 aoe q arcane_explosion Fluffy_Pillow 15705.2/63371: 25% mana arcane_charge(3), clearcasting
3:29.837 aoe r arcane_barrage Fluffy_Pillow 17363.0/63371: 27% mana arcane_charge(4)
3:31.143 aoe q arcane_explosion Fluffy_Pillow 21553.2/63371: 34% mana
3:32.449 aoe q arcane_explosion Fluffy_Pillow 18208.4/63371: 29% mana arcane_charge, clearcasting
3:33.756 aoe q arcane_explosion Fluffy_Pillow 19865.0/63371: 31% mana arcane_charge(2)
3:35.062 aoe q arcane_explosion Fluffy_Pillow 16520.2/63371: 26% mana arcane_charge(3), clearcasting
3:36.368 aoe r arcane_barrage Fluffy_Pillow 18175.5/63371: 29% mana arcane_charge(4)
3:37.674 aoe m touch_of_the_magi Fluffy_Pillow 22365.6/63371: 35% mana
3:38.979 aoe o rune_of_power Fluffy_Pillow 21519.6/63371: 34% mana arcane_charge(4)
3:40.284 aoe r arcane_barrage Fluffy_Pillow 23173.6/63371: 37% mana arcane_charge(4), rune_of_power
3:41.591 aoe p arcane_orb Fluffy_Pillow 27365.0/63371: 43% mana rune_of_power
3:42.898 aoe r arcane_barrage Fluffy_Pillow 28521.5/63371: 45% mana arcane_charge(4), rune_of_power
3:44.205 aoe q arcane_explosion Fluffy_Pillow 32712.9/63371: 52% mana rune_of_power
3:45.512 aoe q arcane_explosion Fluffy_Pillow 29369.4/63371: 46% mana arcane_charge, rune_of_power
3:46.819 aoe q arcane_explosion Fluffy_Pillow 26025.9/63371: 41% mana arcane_charge(2), clearcasting, rune_of_power
3:48.126 aoe q arcane_explosion Fluffy_Pillow 27682.5/63371: 44% mana arcane_charge(3), rune_of_power
3:49.433 aoe r arcane_barrage Fluffy_Pillow 24339.0/63371: 38% mana arcane_charge(4), rune_of_power
3:50.740 aoe j radiant_spark Fluffy_Pillow 28530.4/63371: 45% mana rune_of_power
3:52.048 aoe q arcane_explosion Fluffy_Pillow 29188.2/63371: 46% mana rune_of_power
3:53.355 aoe q arcane_explosion Fluffy_Pillow 25844.7/63371: 41% mana arcane_charge, rune_of_power
3:54.662 aoe q arcane_explosion Fluffy_Pillow 22501.2/63371: 36% mana arcane_charge(2), clearcasting, rune_of_power
3:55.968 aoe q arcane_explosion Fluffy_Pillow 24156.5/63371: 38% mana arcane_charge(3)
3:57.274 aoe r arcane_barrage Fluffy_Pillow 20811.8/63371: 33% mana arcane_charge(4), clearcasting
3:58.584 aoe q arcane_explosion Fluffy_Pillow 25007.0/63371: 39% mana clearcasting
3:59.890 aoe q arcane_explosion Fluffy_Pillow 26662.2/63371: 42% mana arcane_charge
4:01.196 aoe q arcane_explosion Fluffy_Pillow 23317.5/63371: 37% mana arcane_charge(2)
4:02.503 aoe q arcane_explosion Fluffy_Pillow 19974.0/63371: 32% mana arcane_charge(3)
4:03.808 aoe r arcane_barrage Fluffy_Pillow 16628.0/63371: 26% mana arcane_charge(4)
4:05.113 aoe p arcane_orb Fluffy_Pillow 20816.9/63371: 33% mana
4:06.420 aoe r arcane_barrage Fluffy_Pillow 21973.4/63371: 35% mana arcane_charge(4)
4:07.725 aoe q arcane_explosion Fluffy_Pillow 26162.2/63371: 41% mana
4:09.032 aoe q arcane_explosion Fluffy_Pillow 22818.8/63371: 36% mana arcane_charge
4:10.337 aoe q arcane_explosion Fluffy_Pillow 19472.8/63371: 31% mana arcane_charge(2)
4:11.646 aoe q arcane_explosion Fluffy_Pillow 16131.8/63371: 25% mana arcane_charge(3)
4:12.951 aoe r arcane_barrage Fluffy_Pillow 12785.8/63371: 20% mana arcane_charge(4)
4:14.256 aoe q arcane_explosion Fluffy_Pillow 16974.7/63371: 27% mana
4:15.563 aoe q arcane_explosion Fluffy_Pillow 13631.2/63371: 22% mana arcane_charge
4:16.869 aoe q arcane_explosion Fluffy_Pillow 10286.5/63371: 16% mana arcane_charge(2)
4:18.177 aoe q arcane_explosion Fluffy_Pillow 6944.3/63371: 11% mana arcane_charge(3)
4:19.484 aoe r arcane_barrage Fluffy_Pillow 3600.8/63371: 6% mana arcane_charge(4)
4:20.791 aoe q arcane_explosion Fluffy_Pillow 7792.2/63371: 12% mana
4:22.095 aoe s evocation Kyrian_Pelagos 4444.9/63371: 7% mana arcane_charge
4:26.439 aoe k radiant_spark Fluffy_Pillow 58289.6/63371: 92% mana arcane_charge
4:27.746 aoe m touch_of_the_magi Fluffy_Pillow 62661.5/67366: 93% mana arcane_charge, combat_meditation
4:29.051 aoe n arcane_power Fluffy_Pillow 61919.7/67366: 92% mana arcane_charge(4), combat_meditation
4:29.051 shared_cds v berserking Fluffy_Pillow 61919.7/67366: 92% mana arcane_charge(4), arcane_power, rune_of_power, combat_meditation
4:29.051 aoe r arcane_barrage Fluffy_Pillow 61919.7/67366: 92% mana berserking, arcane_charge(4), arcane_power, rune_of_power, combat_meditation
4:30.241 aoe p arcane_orb Fluffy_Pillow 66217.6/67366: 98% mana berserking, arcane_power, rune_of_power, combat_meditation
4:31.429 aoe r arcane_barrage Fluffy_Pillow 67365.7/67366: 100% mana berserking, arcane_charge(4), arcane_power, rune_of_power, combat_meditation
4:32.617 aoe q arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana berserking, arcane_power, rune_of_power, combat_meditation
4:33.803 aoe q arcane_explosion Fluffy_Pillow 62522.8/63371: 99% mana berserking, arcane_charge, arcane_power, rune_of_power
4:34.991 aoe q arcane_explosion Fluffy_Pillow 61528.5/63371: 97% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:36.180 aoe q arcane_explosion Fluffy_Pillow 60535.5/63371: 96% mana berserking, arcane_charge(3), arcane_power, rune_of_power
4:37.370 aoe r arcane_barrage Fluffy_Pillow 59543.7/63371: 94% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:38.558 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana berserking, arcane_power, rune_of_power
4:39.746 aoe q arcane_explosion Fluffy_Pillow 62377.1/63371: 98% mana berserking, arcane_charge, arcane_power, rune_of_power
4:40.935 aoe q arcane_explosion Fluffy_Pillow 61384.1/63371: 97% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:42.124 aoe q arcane_explosion Fluffy_Pillow 60391.1/63371: 95% mana arcane_charge(3), arcane_power, rune_of_power
4:43.432 aoe r arcane_barrage Fluffy_Pillow 59548.9/63371: 94% mana arcane_charge(4), arcane_power, rune_of_power
4:44.739 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana
4:46.045 aoe q arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge
4:47.351 aoe q arcane_explosion Fluffy_Pillow 56682.0/63371: 89% mana arcane_charge(2)
4:48.657 shared_cds t use_mana_gem Kyrian_Pelagos 53337.2/63371: 84% mana arcane_charge(3)
4:48.657 aoe q arcane_explosion Fluffy_Pillow 59674.4/63371: 94% mana arcane_charge(3)
4:49.963 aoe o rune_of_power Fluffy_Pillow 56329.6/63371: 89% mana arcane_charge(4)
4:51.269 aoe r arcane_barrage Fluffy_Pillow 57984.9/63371: 92% mana arcane_charge(4), rune_of_power
4:52.575 aoe p arcane_orb Fluffy_Pillow 62175.0/63371: 98% mana rune_of_power
4:53.883 aoe r arcane_barrage Fluffy_Pillow 63332.8/63371: 100% mana arcane_charge(4), rune_of_power
4:55.187 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
4:56.493 aoe q arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge, clearcasting, rune_of_power
4:57.798 aoe j radiant_spark Fluffy_Pillow 61680.7/63371: 97% mana arcane_charge(2), rune_of_power
4:59.104 aoe q arcane_explosion Fluffy_Pillow 62335.9/63371: 98% mana arcane_charge(2), rune_of_power
5:00.409 aoe q arcane_explosion Fluffy_Pillow 58989.9/63371: 93% mana arcane_charge(3), rune_of_power
5:01.715 aoe r arcane_barrage Fluffy_Pillow 55645.2/63371: 88% mana arcane_charge(4), rune_of_power
5:03.022 aoe q arcane_explosion Fluffy_Pillow 59836.6/63371: 94% mana rune_of_power
5:04.328 aoe q arcane_explosion Fluffy_Pillow 56491.9/63371: 89% mana arcane_charge, rune_of_power
5:05.635 aoe q arcane_explosion Fluffy_Pillow 53148.4/63371: 84% mana arcane_charge(2), rune_of_power
5:06.942 aoe q arcane_explosion Fluffy_Pillow 49804.9/63371: 79% mana arcane_charge(3), clearcasting
5:08.248 aoe r arcane_barrage Fluffy_Pillow 51460.2/63371: 81% mana arcane_charge(4)
5:09.554 aoe q arcane_explosion Fluffy_Pillow 55650.3/63371: 88% mana
5:10.860 aoe q arcane_explosion Fluffy_Pillow 52305.6/63371: 83% mana arcane_charge
5:12.165 aoe q arcane_explosion Fluffy_Pillow 48959.5/63371: 77% mana arcane_charge(2)
5:13.470 aoe q arcane_explosion Fluffy_Pillow 45613.5/63371: 72% mana arcane_charge(3)
5:14.778 aoe r arcane_barrage Fluffy_Pillow 42271.3/63371: 67% mana arcane_charge(4)
5:16.085 aoe p arcane_orb Fluffy_Pillow 46462.7/63371: 73% mana
5:17.390 aoe r arcane_barrage Fluffy_Pillow 47616.7/63371: 75% mana arcane_charge(4)
5:18.695 aoe q arcane_explosion Fluffy_Pillow 51805.6/63371: 82% mana
5:20.001 aoe q arcane_explosion Fluffy_Pillow 48460.8/63371: 76% mana arcane_charge
5:21.306 aoe q arcane_explosion Fluffy_Pillow 45114.8/63371: 71% mana arcane_charge(2)
5:22.613 aoe q arcane_explosion Fluffy_Pillow 41771.4/63371: 66% mana arcane_charge(3)
5:23.919 aoe r arcane_barrage Fluffy_Pillow 38426.6/63371: 61% mana arcane_charge(4)
5:25.226 aoe q arcane_explosion Fluffy_Pillow 42618.0/63371: 67% mana
5:26.533 aoe q arcane_explosion Fluffy_Pillow 39274.5/63371: 62% mana arcane_charge
5:27.840 aoe q arcane_explosion Fluffy_Pillow 35931.1/63371: 57% mana arcane_charge(2)
5:29.147 aoe q arcane_explosion Fluffy_Pillow 32587.6/63371: 51% mana arcane_charge(3)
5:30.453 aoe r arcane_barrage Fluffy_Pillow 29242.9/63371: 46% mana arcane_charge(4)
5:31.760 aoe q arcane_explosion Fluffy_Pillow 33434.2/63371: 53% mana
5:33.066 aoe q arcane_explosion Fluffy_Pillow 30089.5/63371: 47% mana arcane_charge
5:34.374 aoe q arcane_explosion Fluffy_Pillow 26747.3/63371: 42% mana arcane_charge(2)
5:35.680 aoe q arcane_explosion Fluffy_Pillow 23402.6/63371: 37% mana arcane_charge(3)
5:36.986 aoe r arcane_barrage Fluffy_Pillow 20057.8/63371: 32% mana arcane_charge(4)
5:38.293 aoe k radiant_spark Fluffy_Pillow 24249.2/63371: 38% mana
5:39.600 aoe m touch_of_the_magi Fluffy_Pillow 26475.5/67366: 39% mana combat_meditation
5:40.907 aoe o rune_of_power Fluffy_Pillow 25736.5/67366: 38% mana arcane_charge(4), combat_meditation
5:42.214 aoe r arcane_barrage Fluffy_Pillow 27497.4/67366: 41% mana arcane_charge(4), rune_of_power, combat_meditation
5:43.521 aoe p arcane_orb Fluffy_Pillow 31953.0/67366: 47% mana rune_of_power, combat_meditation
5:44.827 aoe r arcane_barrage Fluffy_Pillow 33212.6/67366: 49% mana arcane_charge(4), rune_of_power, combat_meditation
5:46.133 aoe q arcane_explosion Fluffy_Pillow 37666.8/67366: 56% mana rune_of_power, combat_meditation
5:47.440 aoe q arcane_explosion Fluffy_Pillow 34427.7/67366: 51% mana arcane_charge, rune_of_power, combat_meditation
5:48.747 aoe q arcane_explosion Fluffy_Pillow 29339.4/63371: 46% mana arcane_charge(2), rune_of_power
5:50.052 aoe q arcane_explosion Fluffy_Pillow 25993.4/63371: 41% mana arcane_charge(3), rune_of_power
5:51.358 aoe r arcane_barrage Fluffy_Pillow 22648.7/63371: 36% mana arcane_charge(4), rune_of_power
5:52.664 aoe q arcane_explosion Fluffy_Pillow 26838.8/63371: 42% mana rune_of_power
5:53.970 aoe q arcane_explosion Fluffy_Pillow 23494.1/63371: 37% mana arcane_charge, rune_of_power
5:55.276 aoe q arcane_explosion Fluffy_Pillow 20149.3/63371: 32% mana arcane_charge(2), clearcasting, rune_of_power
5:56.581 aoe q arcane_explosion Fluffy_Pillow 21803.3/63371: 34% mana arcane_charge(3), rune_of_power

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Kyrian_Pelagos"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=kyrian
soulbind=328266//arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Necrolord_Emeni : 11592 dps, 4949 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
11592.0 11592.0 23.0 / 0.198% 1759.1 / 15.2% 5.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
2174.1 2060.8 Mana 0.00% 49.2 100.0% 100%
Talents
Necrolord

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necrolord_Emeni 11592
Arcane Barrage 2299 19.8% 49.7 5.62sec 13906 10881 Direct 149.0 3890 7795 4643 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 49.75 149.03 0.00 0.00 1.2780 0.0000 691775.24 691775.24 0.00% 10881.42 10881.42
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 120.30 89 160 3890.12 1153 14430 3888.73 3564 4270 467894 467894 0.00%
crit 19.28% 28.73 14 52 7794.98 2307 28860 7787.55 5370 10525 223882 223882 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [r]:49.62
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
    rotation
    [u]:0.01
  • if_expr:cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
    rotation
    [x]:0.11
Arcane Blast 3225 27.9% 29.6 8.08sec 32922 30684 Direct 85.7 9535 19040 11385 19.5%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.64 85.71 0.00 0.00 1.0729 0.0000 975867.58 975867.58 0.00% 30683.80 30683.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.54% 69.02 37 92 9534.55 1009 14446 9542.29 8019 10320 658195 658195 0.00%
crit 19.46% 16.68 4 31 19040.25 2019 28891 19072.53 12709 26994 317673 317673 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r

Action Priority List

    aoe
    [o]:29.74
  • if_expr:buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
    rotation
    [w]:0.07
Arcane Echo 274 2.4% 37.9 7.46sec 2175 0 Direct 113.7 607 1217 725 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.91 113.73 0.00 0.00 0.0000 0.0000 82460.93 82460.93 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 91.73 62 122 607.38 443 877 606.59 528 671 55701 55701 0.00%
crit 19.34% 22.00 9 45 1216.69 886 1754 1215.77 886 1682 26760 26760 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 4029 34.7% 129.7 2.11sec 9334 7312 Direct 389.2 2608 5219 3112 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 129.72 389.17 0.00 0.00 1.2765 0.0000 1210800.58 1210800.58 0.00% 7311.86 7311.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 314.15 250 393 2608.37 2128 4469 2609.16 2527 2692 819359 819359 0.00%
crit 19.28% 75.02 39 112 5218.59 4256 8938 5219.93 4780 5703 391442 391442 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.546000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 54.6%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [q]:129.69
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (706) 0.0% (6.1%) 11.5 25.05sec 18421 14386

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.54 0.00 0.00 0.00 1.2805 0.0000 0.00 0.00 0.00% 14386.23 14386.23

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [p]:11.52
  • if_expr:buff.arcane_charge.stack=0
    rotation
    [v]:0.01
  • if_expr:buff.arcane_charge.stack<=variable.totm_max_charges
    Arcane Orb (_bolt) 706 6.1% 34.5 25.04sec 6152 0 Direct 34.5 5162 10295 6152 19.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.54 34.54 0.00 0.00 0.0000 0.0000 212484.55 212484.55 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 27.86 17 41 5161.64 3869 8126 5164.97 4456 5664 143774 143774 0.00%
crit 19.33% 6.68 1 15 10294.52 7739 16251 10287.28 7739 16251 68710 68710 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (64) 0.0% (0.5%) 13.7 1.81sec 1390 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.73 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 64 0.5% 13.7 1.81sec 1390 0 Direct 13.7 1164 2327 1390 19.5%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.73 13.73 0.00 0.00 0.0000 0.0000 19086.34 19086.34 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.55% 11.06 5 18 1163.53 1164 1164 1163.53 1164 1164 12871 12871 0.00%
crit 19.45% 2.67 0 9 2327.06 2327 2327 2195.66 0 2327 6216 6216 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1802 21.8%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1803.45 1803.45 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.20% 0.78 0 1 1480.68 1481 1481 1157.90 0 1481 1158 1158 0.00%
crit 21.80% 0.22 0 1 2961.35 2961 2961 645.55 0 2961 646 646 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (24) 0.0% (0.2%) 1.0 0.00sec 7049 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 176  / 24 0.2% 90.0 1.29sec 78 60 Direct 90.0 66 131 78 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 7049.30 7049.30 0.00% 59.85 59.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 72.59 60 84 65.66 43 72 65.66 64 68 4766 4766 0.00%
crit 19.34% 17.41 6 30 131.14 86 145 131.11 106 145 2283 2283 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (964) 0.0% (8.3%) 6.1 52.58sec 47328 37634

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.14 0.00 0.00 0.00 1.2576 0.0000 0.00 0.00 0.00% 37633.81 37633.81

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.16
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 964 8.3% 6.1 52.47sec 47328 0 Direct 18.3 15859 0 15859 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.14 18.33 0.00 0.00 0.0000 0.0000 290495.37 290495.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.33 15 24 15859.22 1517 81567 15826.91 10073 20767 290495 290495 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:35262.11
  • base_dd_max:35262.11
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Necrolord_Emeni
Arcane Power 2.8 129.41sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.84
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 258.73sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [{]:1.84
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Deathborne 1.8 258.75sec

Stats Details: Deathborne

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.84 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathborne

  • id:324220
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:324220
  • name:Deathborne
  • school:shadow
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.

Action Priority List

    aoe
    [j]:1.86
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Evocation 2.0 173.30sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.04 0.00 12.08 0.00 4.0122 0.6741 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [s]:2.04
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [z]:1.00
  • if_expr:buff.arcane_power.up
Presence of Mind 1.8 257.54sec

Stats Details: Presence Of Mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Presence Of Mind

  • id:205025
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:205025
  • name:Presence of Mind
  • school:arcane
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.

Action Priority List

    aoe
    [n]:1.80
  • if_expr:buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
    cooldowns
    [t]:0.00
  • if_expr:debuff.touch_of_the_magi.up&!covenant.kyrian.enabled
Rune of Power 6.0 50.91sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.97 0.00 0.00 0.00 1.2562 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:5.99
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 3.0 120.97sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [y]:2.95
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 50.5 161.1 6.0sec 1.4sec 4.5sec 75.66% 0.00% 28.8 (29.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.0s / 30.9s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 29.6s

Stack Uptimes

  • arcane_charge_1:16.80%
  • arcane_charge_2:14.83%
  • arcane_charge_3:14.95%
  • arcane_charge_4:29.09%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 129.5sec 129.5sec 14.7sec 13.79% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.5s / 138.9s
  • trigger_min/max:121.5s / 138.9s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 15.0s

Stack Uptimes

  • arcane_power_1:13.79%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 258.8sec 258.8sec 11.7sec 7.06% 32.55% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:253.3s / 267.9s
  • trigger_min/max:253.3s / 267.9s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 12.0s

Stack Uptimes

  • berserking_1:7.06%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.46% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.46%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.6 3.5 13.1sec 11.3sec 3.2sec 23.89% 0.00% 1.1 (1.1) 0.3

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:17.80%
  • clearcasting_2:3.04%
  • clearcasting_3:3.06%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Deathborne 1.8 0.0 258.9sec 258.9sec 19.1sec 11.58% 0.00% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_deathborne
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:254.3s / 267.6s
  • trigger_min/max:254.3s / 267.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • deathborne_1:11.58%

Spelldata

  • id:324220
  • name:Deathborne
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Evocation 2.0 0.0 173.3sec 173.3sec 4.0sec 2.69% 0.00% 8.0 (8.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:90.0s / 288.4s
  • trigger_min/max:90.0s / 288.4s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 4.3s

Stack Uptimes

  • evocation_1:2.69%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Lead by Example 1.8 0.0 258.9sec 258.9sec 28.0sec 16.93% 0.00% 0.0 (0.0) 1.6

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_lead_by_example
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:254.3s / 267.6s
  • trigger_min/max:254.3s / 267.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • lead_by_example_1:16.93%

Spelldata

  • id:342181
  • name:Lead by Example
  • tooltip:$pri increased by $w1%.
  • description:{$@spelldesc342156=$?a137005[Abomination Limb]?a212611[Fodder to the Flame]?a137009[Adaptive Swarm]?a137014[Death Chakram]?a137018[Deathborne]?a137022[Bonedust Brew]?a137026[Vanquisher's Hammer]?a137030[Unholy Nova]?a137034[Serrated Bone Spike]?a137038[Primordial Wave]?a137042[Decimating Bolt]?a137047[Conqueror's Banner][Activating your Necrolord class ability] increases your $pri by {$342181s2=5}% and nearby allies' primary stat by {$342181s1=2}% for ${{$s3=10}*$<mod>}.1 sec. You gain {$342181s2=5}% additional $pri for each ally affected, up to ${({$342181s3=3}*{$342181s2=5})}%.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.41% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.41%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Presence of Mind 1.8 0.0 257.3sec 257.3sec 2.3sec 1.34% 17.95% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_presence_of_mind
  • max_stacks:3
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:110.6s / 267.1s
  • trigger_min/max:110.6s / 267.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 145.3s

Stack Uptimes

  • presence_of_mind_1:0.62%
  • presence_of_mind_2:0.62%
  • presence_of_mind_3:0.10%

Spelldata

  • id:205025
  • name:Presence of Mind
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.
  • max_stacks:0
  • duration:-0.00
  • cooldown:60.00
  • default_chance:100.00%
Rune of Power 8.8 0.0 35.5sec 35.5sec 14.7sec 42.89% 0.00% 0.0 (0.0) 8.4

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.7s / 54.1s
  • trigger_min/max:15.7s / 54.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • rune_of_power_1:42.89%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 1 0.03% 0.00% 3.28%
Arcane Barrage Arcane Charge 2 0.07% 0.00% 5.26%
Arcane Barrage Arcane Charge 3 0.12% 0.00% 4.44%
Arcane Barrage Arcane Charge 4 99.78% 89.47% 100.00%
Arcane Blast Arcane Charge 0 1.28% 0.00% 7.14%
Arcane Blast Arcane Charge 1 1.08% 0.00% 8.11%
Arcane Blast Arcane Charge 2 0.99% 0.00% 6.90%
Arcane Blast Arcane Charge 3 0.62% 0.00% 6.67%
Arcane Blast Arcane Charge 4 96.02% 73.33% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 0.50% 0.14% 4.06% 0.8s 0.0s 3.9s
Conserve Phase 100.00% 100.00% 100.00% 301.2s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000181.223120.154239.984
Evocation63.6140.000198.424152.73668.262256.864
Rune of Power6.8800.06650.11042.94424.41979.383
Touch of the Magi5.4280.00027.77935.16021.80758.473
Arcane Power6.9371.49018.90720.00810.84730.167
Arcane Barrage3.4710.00328.292174.977134.289211.538
Arcane Orb6.5730.01135.01577.87451.536100.167
Deathborne35.5590.00086.24976.24958.85286.249
Presence of Mind91.2017.898205.274205.44456.655235.779

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necrolord_Emeni
mana_regen Mana 822.54 378895.19 61.04% 460.64 2296.49 0.60%
Evocation Mana 90.90 98045.82 15.79% 1078.64 0.00 0.00%
Mana Gem Mana 2.95 18698.48 3.01% 6337.14 0.00 0.00%
Arcane Barrage Mana 49.73 125104.75 20.15% 2515.50 845.04 0.67%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 2060.77 2174.10 3150.9 29232.2 6.9 63371.4
Usage Type Count Total Avg RPE APR
Necrolord_Emeni
arcane_blast Mana 29.7 118774.4 4002.6 4006.9 8.2
arcane_explosion Mana 129.7 509673.5 3929.9 3929.0 2.4
arcane_orb Mana 11.5 5515.4 478.3 478.1 38.5
deathborne Mana 1.8 4615.0 2500.0 2502.2 0.0
touch_of_the_magi Mana 6.1 15341.1 2500.0 2499.4 18.9

Statistics & Data Analysis

Fight Length
Necrolord_Emeni Fight Length
Count 1523
Mean 301.22
Minimum 240.15
Maximum 359.98
Spread ( max - min ) 119.83
Range [ ( max - min ) / 2 * 100% ] 19.89%
DPS
Necrolord_Emeni Damage Per Second
Count 1523
Mean 11591.98
Minimum 10469.76
Maximum 12906.96
Spread ( max - min ) 2437.20
Range [ ( max - min ) / 2 * 100% ] 10.51%
Standard Deviation 457.2208
5th Percentile 10841.56
95th Percentile 12321.47
( 95th Percentile - 5th Percentile ) 1479.90
Mean Distribution
Standard Deviation 11.7159
95.00% Confidence Interval ( 11569.02 - 11614.94 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 5977
0.1 Scale Factor Error with Delta=300 1785
0.05 Scale Factor Error with Delta=300 7139
0.01 Scale Factor Error with Delta=300 178458
Priority Target DPS
Necrolord_Emeni Priority Target Damage Per Second
Count 1523
Mean 4948.92
Minimum 4311.14
Maximum 5666.85
Spread ( max - min ) 1355.70
Range [ ( max - min ) / 2 * 100% ] 13.70%
Standard Deviation 246.2749
5th Percentile 4538.32
95th Percentile 5346.80
( 95th Percentile - 5th Percentile ) 808.49
Mean Distribution
Standard Deviation 6.3106
95.00% Confidence Interval ( 4936.55 - 4961.29 )
Normalized 95.00% Confidence Interval ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 96
0.1% Error 9513
0.1 Scale Factor Error with Delta=300 518
0.05 Scale Factor Error with Delta=300 2072
0.01 Scale Factor Error with Delta=300 51776
DPS(e)
Necrolord_Emeni Damage Per Second (Effective)
Count 1523
Mean 11591.98
Minimum 10469.76
Maximum 12906.96
Spread ( max - min ) 2437.20
Range [ ( max - min ) / 2 * 100% ] 10.51%
Damage
Necrolord_Emeni Damage
Count 1523
Mean 3484774.05
Minimum 2571018.95
Maximum 4380846.16
Spread ( max - min ) 1809827.20
Range [ ( max - min ) / 2 * 100% ] 25.97%
DTPS
Necrolord_Emeni Damage Taken Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necrolord_Emeni Healing Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necrolord_Emeni Healing Per Second (Effective)
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necrolord_Emeni Heal
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necrolord_Emeni Healing Taken Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necrolord_Emeni Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Necrolord_EmeniTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necrolord_Emeni Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 1.86 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.16 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.84 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 5.99 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
n 1.80 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
o 29.74 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
p 11.52 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
q 129.69 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
r 49.62 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
s 2.04 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation
# count action,conditions
0.00 variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
u 0.01 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
0.00 strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
0.00 arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
0.00 arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
0.00 arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
0.00 arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
0.00 arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
v 0.01 arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
0.00 supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
0.00 arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
w 0.07 arcane_blast
0.00 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
x 0.11 arcane_barrage
actions.shared_cds
# count action,conditions
y 2.95 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
z 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
{ 1.84 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjklz{oooyooonoooooooooomooorprqqqqrqqqqrqqqqrqsqqqrprqqqqrqqqqrkmrqqqqrprqqqqrqqqqrqqqqrprqqqqrqqqqrkmrqqqqrpyrqqqqlrqqqqrqqqqrprqqqqrqqqqrkmrqqqqrprqqqqrqsqqqrprqqqqrqqqqrqkmrprqqqqrqqqqrqqqqrprqqqqrqyqqqrqqqqrjkl{oooonooooooooomoorprqqqqrqqqqrqqqqrprqqqqrqqqsqrkmrprqqqqrqqqqrqqqqrprqqqq

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Necrolord_Emeni 63371.4/63371: 100% mana
Pre precombat R food Necrolord_Emeni 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j deathborne Fluffy_Pillow 62371.4/63371: 98% mana
0:01.306 aoe k touch_of_the_magi Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, deathborne, lead_by_example
0:02.312 aoe l arcane_power Fluffy_Pillow 59651.5/63371: 94% mana bloodlust, arcane_charge(4), deathborne, lead_by_example
0:02.312 shared_cds z potion Fluffy_Pillow 59651.5/63371: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example
0:02.312 shared_cds { berserking Fluffy_Pillow 59651.5/63371: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:02.312 aoe o arcane_blast Fluffy_Pillow 59651.5/63371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:03.246 aoe o arcane_blast Fluffy_Pillow 57397.8/63371: 91% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:04.179 aoe o arcane_blast Fluffy_Pillow 55142.8/63371: 87% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:05.112 shared_cds y use_mana_gem Necrolord_Emeni 52887.8/63371: 83% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:05.112 aoe o arcane_blast Fluffy_Pillow 59225.0/63371: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:06.045 aoe o arcane_blast Fluffy_Pillow 56970.0/63371: 90% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:06.979 aoe o arcane_blast Fluffy_Pillow 54716.3/63371: 86% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:07.911 aoe n presence_of_mind Fluffy_Pillow 52460.0/63371: 83% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:07.911 aoe o arcane_blast Fluffy_Pillow 52460.0/63371: 83% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:08.826 aoe o arcane_blast Fluffy_Pillow 50182.2/63371: 79% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, presence_of_mind(2), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:09.740 aoe o arcane_blast Fluffy_Pillow 47903.1/63371: 76% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, presence_of_mind, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:10.654 aoe o arcane_blast Fluffy_Pillow 45624.1/63371: 72% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:11.586 aoe o arcane_blast Fluffy_Pillow 43367.8/63371: 68% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:12.518 aoe o arcane_blast Fluffy_Pillow 41111.6/63371: 65% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:13.452 aoe o arcane_blast Fluffy_Pillow 38857.8/63371: 61% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:14.384 aoe o arcane_blast Fluffy_Pillow 36601.6/63371: 58% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:15.409 aoe o arcane_blast Fluffy_Pillow 34463.2/63371: 54% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:16.436 aoe o arcane_blast Fluffy_Pillow 32327.3/63371: 51% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:17.463 aoe m rune_of_power Fluffy_Pillow 26754.0/63371: 42% mana bloodlust, arcane_charge(4), clearcasting, deathborne, lead_by_example, potion_of_deathly_fixation
0:18.471 aoe o arcane_blast Fluffy_Pillow 28031.6/63371: 44% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:19.498 aoe o arcane_blast Fluffy_Pillow 22458.2/63371: 35% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:20.525 aoe o arcane_blast Fluffy_Pillow 16884.9/63371: 27% mana bloodlust, arcane_charge(4), clearcasting(2), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:21.553 aoe r arcane_barrage Fluffy_Pillow 11312.8/63371: 18% mana bloodlust, arcane_charge(4), clearcasting(2), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:22.558 aoe p arcane_orb Fluffy_Pillow 15121.4/63371: 24% mana bloodlust, clearcasting(2), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:23.563 aoe r arcane_barrage Fluffy_Pillow 15895.2/63371: 25% mana bloodlust, arcane_charge(4), clearcasting(2), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:24.569 aoe q arcane_explosion Fluffy_Pillow 19705.0/63371: 31% mana bloodlust, clearcasting(2), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:25.574 aoe q arcane_explosion Fluffy_Pillow 20978.8/63371: 33% mana bloodlust, arcane_charge, clearcasting, rune_of_power, lead_by_example, potion_of_deathly_fixation
0:26.580 aoe q arcane_explosion Fluffy_Pillow 22253.8/63371: 35% mana bloodlust, arcane_charge(2), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:27.586 aoe q arcane_explosion Fluffy_Pillow 18528.9/63371: 29% mana bloodlust, arcane_charge(3), rune_of_power, lead_by_example
0:28.591 aoe r arcane_barrage Fluffy_Pillow 14802.6/63371: 23% mana bloodlust, arcane_charge(4), rune_of_power, lead_by_example
0:29.597 aoe q arcane_explosion Fluffy_Pillow 18612.5/63371: 29% mana bloodlust, rune_of_power, lead_by_example
0:30.603 aoe q arcane_explosion Fluffy_Pillow 14887.6/63371: 23% mana bloodlust, arcane_charge, rune_of_power, lead_by_example
0:31.609 aoe q arcane_explosion Fluffy_Pillow 11162.6/63371: 18% mana bloodlust, arcane_charge(2), rune_of_power
0:32.616 aoe q arcane_explosion Fluffy_Pillow 7438.9/63371: 12% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power
0:33.621 aoe r arcane_barrage Fluffy_Pillow 8712.7/63371: 14% mana bloodlust, arcane_charge(4)
0:34.628 aoe q arcane_explosion Fluffy_Pillow 12523.8/63371: 20% mana bloodlust
0:35.635 aoe q arcane_explosion Fluffy_Pillow 8800.1/63371: 14% mana bloodlust, arcane_charge, clearcasting
0:36.640 aoe q arcane_explosion Fluffy_Pillow 10073.9/63371: 16% mana bloodlust, arcane_charge(2)
0:37.645 aoe q arcane_explosion Fluffy_Pillow 6347.7/63371: 10% mana bloodlust, arcane_charge(3)
0:38.651 aoe r arcane_barrage Fluffy_Pillow 2622.7/63371: 4% mana bloodlust, arcane_charge(4)
0:39.657 aoe q arcane_explosion Fluffy_Pillow 6432.6/63371: 10% mana bloodlust
0:40.665 aoe s evocation Necrolord_Emeni 2710.1/63371: 4% mana bloodlust, arcane_charge
0:44.009 aoe q arcane_explosion Fluffy_Pillow 56579.6/63371: 89% mana arcane_charge
0:45.315 aoe q arcane_explosion Fluffy_Pillow 53234.9/63371: 84% mana arcane_charge(2)
0:46.621 aoe q arcane_explosion Fluffy_Pillow 49890.1/63371: 79% mana arcane_charge(3)
0:47.928 aoe r arcane_barrage Fluffy_Pillow 46546.7/63371: 73% mana arcane_charge(4)
0:49.234 aoe p arcane_orb Fluffy_Pillow 50736.8/63371: 80% mana
0:50.539 aoe r arcane_barrage Fluffy_Pillow 51890.8/63371: 82% mana arcane_charge(4)
0:51.844 aoe q arcane_explosion Fluffy_Pillow 56079.6/63371: 88% mana
0:53.150 aoe q arcane_explosion Fluffy_Pillow 52734.9/63371: 83% mana arcane_charge, clearcasting
0:54.458 aoe q arcane_explosion Fluffy_Pillow 54392.7/63371: 86% mana arcane_charge(2)
0:55.764 aoe q arcane_explosion Fluffy_Pillow 51048.0/63371: 81% mana arcane_charge(3)
0:57.071 aoe r arcane_barrage Fluffy_Pillow 47704.5/63371: 75% mana arcane_charge(4)
0:58.377 aoe q arcane_explosion Fluffy_Pillow 51894.6/63371: 82% mana
0:59.686 aoe q arcane_explosion Fluffy_Pillow 48553.7/63371: 77% mana arcane_charge, clearcasting
1:00.993 aoe q arcane_explosion Fluffy_Pillow 50210.2/63371: 79% mana arcane_charge(2)
1:02.299 aoe q arcane_explosion Fluffy_Pillow 46865.5/63371: 74% mana arcane_charge(3)
1:03.606 aoe r arcane_barrage Fluffy_Pillow 43522.0/63371: 69% mana arcane_charge(4)
1:04.912 aoe k touch_of_the_magi Fluffy_Pillow 47712.1/63371: 75% mana
1:06.219 aoe m rune_of_power Fluffy_Pillow 46868.6/63371: 74% mana arcane_charge(4)
1:07.524 aoe r arcane_barrage Fluffy_Pillow 48522.6/63371: 77% mana arcane_charge(4), rune_of_power
1:08.830 aoe q arcane_explosion Fluffy_Pillow 52712.8/63371: 83% mana rune_of_power
1:10.135 aoe q arcane_explosion Fluffy_Pillow 49366.8/63371: 78% mana arcane_charge, clearcasting, rune_of_power
1:11.442 aoe q arcane_explosion Fluffy_Pillow 51023.3/63371: 81% mana arcane_charge(2), rune_of_power
1:12.750 aoe q arcane_explosion Fluffy_Pillow 47681.1/63371: 75% mana arcane_charge(3), rune_of_power
1:14.057 aoe r arcane_barrage Fluffy_Pillow 44337.6/63371: 70% mana arcane_charge(4), rune_of_power
1:15.363 aoe p arcane_orb Fluffy_Pillow 48527.7/63371: 77% mana rune_of_power
1:16.671 aoe r arcane_barrage Fluffy_Pillow 49685.5/63371: 78% mana arcane_charge(4), rune_of_power
1:17.977 aoe q arcane_explosion Fluffy_Pillow 53875.6/63371: 85% mana rune_of_power
1:19.284 aoe q arcane_explosion Fluffy_Pillow 50532.2/63371: 80% mana arcane_charge, clearcasting, rune_of_power
1:20.591 aoe q arcane_explosion Fluffy_Pillow 52188.7/63371: 82% mana arcane_charge(2), rune_of_power
1:21.897 aoe q arcane_explosion Fluffy_Pillow 48844.0/63371: 77% mana arcane_charge(3), rune_of_power
1:23.203 aoe r arcane_barrage Fluffy_Pillow 45499.2/63371: 72% mana arcane_charge(4), clearcasting
1:24.510 aoe q arcane_explosion Fluffy_Pillow 49690.6/63371: 78% mana clearcasting
1:25.815 aoe q arcane_explosion Fluffy_Pillow 51344.6/63371: 81% mana arcane_charge
1:27.121 aoe q arcane_explosion Fluffy_Pillow 47999.9/63371: 76% mana arcane_charge(2)
1:28.428 aoe q arcane_explosion Fluffy_Pillow 44656.4/63371: 70% mana arcane_charge(3)
1:29.734 aoe r arcane_barrage Fluffy_Pillow 41311.7/63371: 65% mana arcane_charge(4)
1:31.042 aoe q arcane_explosion Fluffy_Pillow 45504.3/63371: 72% mana
1:32.347 aoe q arcane_explosion Fluffy_Pillow 42158.3/63371: 67% mana arcane_charge
1:33.652 aoe q arcane_explosion Fluffy_Pillow 38812.3/63371: 61% mana arcane_charge(2)
1:34.959 aoe q arcane_explosion Fluffy_Pillow 35468.8/63371: 56% mana arcane_charge(3)
1:36.265 aoe r arcane_barrage Fluffy_Pillow 32124.1/63371: 51% mana arcane_charge(4)
1:37.572 aoe p arcane_orb Fluffy_Pillow 36315.5/63371: 57% mana
1:38.877 aoe r arcane_barrage Fluffy_Pillow 37469.5/63371: 59% mana arcane_charge(4)
1:40.181 aoe q arcane_explosion Fluffy_Pillow 41657.1/63371: 66% mana
1:41.487 aoe q arcane_explosion Fluffy_Pillow 38312.3/63371: 60% mana arcane_charge
1:42.793 aoe q arcane_explosion Fluffy_Pillow 34967.6/63371: 55% mana arcane_charge(2)
1:44.101 aoe q arcane_explosion Fluffy_Pillow 31625.4/63371: 50% mana arcane_charge(3)
1:45.409 aoe r arcane_barrage Fluffy_Pillow 28283.2/63371: 45% mana arcane_charge(4)
1:46.714 aoe q arcane_explosion Fluffy_Pillow 32472.0/63371: 51% mana
1:48.022 aoe q arcane_explosion Fluffy_Pillow 29129.8/63371: 46% mana arcane_charge
1:49.329 aoe q arcane_explosion Fluffy_Pillow 25786.3/63371: 41% mana arcane_charge(2)
1:50.635 aoe q arcane_explosion Fluffy_Pillow 22441.6/63371: 35% mana arcane_charge(3)
1:51.944 aoe r arcane_barrage Fluffy_Pillow 19100.7/63371: 30% mana arcane_charge(4)
1:53.251 aoe k touch_of_the_magi Fluffy_Pillow 23292.1/63371: 37% mana
1:54.558 aoe m rune_of_power Fluffy_Pillow 22448.6/63371: 35% mana arcane_charge(4)
1:55.864 aoe r arcane_barrage Fluffy_Pillow 24103.8/63371: 38% mana arcane_charge(4), rune_of_power
1:57.168 aoe q arcane_explosion Fluffy_Pillow 28291.4/63371: 45% mana rune_of_power
1:58.477 aoe q arcane_explosion Fluffy_Pillow 24950.5/63371: 39% mana arcane_charge, rune_of_power
1:59.784 aoe q arcane_explosion Fluffy_Pillow 21607.0/63371: 34% mana arcane_charge(2), rune_of_power
2:01.091 aoe q arcane_explosion Fluffy_Pillow 18263.6/63371: 29% mana arcane_charge(3), rune_of_power
2:02.396 aoe r arcane_barrage Fluffy_Pillow 14917.5/63371: 24% mana arcane_charge(4), rune_of_power
2:03.703 aoe p arcane_orb Fluffy_Pillow 19108.9/63371: 30% mana rune_of_power
2:05.010 shared_cds y use_mana_gem Necrolord_Emeni 20265.5/63371: 32% mana arcane_charge(4), rune_of_power
2:05.112 aoe r arcane_barrage Fluffy_Pillow 26731.9/63371: 42% mana arcane_charge(4), rune_of_power
2:06.419 aoe q arcane_explosion Fluffy_Pillow 30923.3/63371: 49% mana rune_of_power
2:07.726 aoe q arcane_explosion Fluffy_Pillow 27579.8/63371: 44% mana arcane_charge, rune_of_power
2:09.033 aoe q arcane_explosion Fluffy_Pillow 24236.3/63371: 38% mana arcane_charge(2), rune_of_power
2:10.340 aoe q arcane_explosion Fluffy_Pillow 20892.9/63371: 33% mana arcane_charge(3), rune_of_power
2:11.646 aoe l arcane_power Fluffy_Pillow 17548.1/63371: 28% mana arcane_charge(4)
2:11.646 aoe r arcane_barrage Fluffy_Pillow 17548.1/63371: 28% mana arcane_charge(4), arcane_power, rune_of_power
2:12.952 aoe q arcane_explosion Fluffy_Pillow 21738.2/63371: 34% mana arcane_power, rune_of_power
2:14.259 aoe q arcane_explosion Fluffy_Pillow 20894.8/63371: 33% mana arcane_charge, arcane_power, rune_of_power
2:15.566 aoe q arcane_explosion Fluffy_Pillow 20051.3/63371: 32% mana arcane_charge(2), arcane_power, rune_of_power
2:16.873 aoe q arcane_explosion Fluffy_Pillow 19207.8/63371: 30% mana arcane_charge(3), arcane_power, rune_of_power
2:18.180 aoe r arcane_barrage Fluffy_Pillow 18364.4/63371: 29% mana arcane_charge(4), arcane_power, rune_of_power
2:19.486 aoe q arcane_explosion Fluffy_Pillow 22554.5/63371: 36% mana arcane_power, rune_of_power
2:20.794 aoe q arcane_explosion Fluffy_Pillow 21712.3/63371: 34% mana arcane_charge, arcane_power, rune_of_power
2:22.101 aoe q arcane_explosion Fluffy_Pillow 20868.8/63371: 33% mana arcane_charge(2), arcane_power, rune_of_power
2:23.409 aoe q arcane_explosion Fluffy_Pillow 20026.6/63371: 32% mana arcane_charge(3), arcane_power, rune_of_power
2:24.716 aoe r arcane_barrage Fluffy_Pillow 19183.1/63371: 30% mana arcane_charge(4), arcane_power, rune_of_power
2:26.023 aoe p arcane_orb Fluffy_Pillow 23374.5/63371: 37% mana arcane_power, rune_of_power
2:27.328 aoe r arcane_barrage Fluffy_Pillow 24778.5/63371: 39% mana arcane_charge(4)
2:28.634 aoe q arcane_explosion Fluffy_Pillow 28968.6/63371: 46% mana
2:29.941 aoe q arcane_explosion Fluffy_Pillow 25625.2/63371: 40% mana arcane_charge
2:31.247 aoe q arcane_explosion Fluffy_Pillow 22280.4/63371: 35% mana arcane_charge(2)
2:32.552 aoe q arcane_explosion Fluffy_Pillow 18934.4/63371: 30% mana arcane_charge(3)
2:33.859 aoe r arcane_barrage Fluffy_Pillow 15590.9/63371: 25% mana arcane_charge(4)
2:35.164 aoe q arcane_explosion Fluffy_Pillow 19779.8/63371: 31% mana
2:36.469 aoe q arcane_explosion Fluffy_Pillow 16433.8/63371: 26% mana arcane_charge
2:37.775 aoe q arcane_explosion Fluffy_Pillow 13089.0/63371: 21% mana arcane_charge(2)
2:39.082 aoe q arcane_explosion Fluffy_Pillow 9745.6/63371: 15% mana arcane_charge(3)
2:40.387 aoe r arcane_barrage Fluffy_Pillow 6399.6/63371: 10% mana arcane_charge(4)
2:41.694 aoe k touch_of_the_magi Fluffy_Pillow 10591.0/63371: 17% mana
2:43.000 aoe m rune_of_power Fluffy_Pillow 9746.2/63371: 15% mana arcane_charge(4), clearcasting
2:44.306 aoe r arcane_barrage Fluffy_Pillow 11401.5/63371: 18% mana arcane_charge(4), clearcasting, rune_of_power
2:45.613 aoe q arcane_explosion Fluffy_Pillow 15592.9/63371: 25% mana clearcasting, rune_of_power
2:46.918 aoe q arcane_explosion Fluffy_Pillow 17246.9/63371: 27% mana arcane_charge, rune_of_power
2:48.224 aoe q arcane_explosion Fluffy_Pillow 13902.1/63371: 22% mana arcane_charge(2), rune_of_power
2:49.530 aoe q arcane_explosion Fluffy_Pillow 10557.4/63371: 17% mana arcane_charge(3), rune_of_power
2:50.836 aoe r arcane_barrage Fluffy_Pillow 7212.6/63371: 11% mana arcane_charge(4), rune_of_power
2:52.144 aoe p arcane_orb Fluffy_Pillow 11405.3/63371: 18% mana rune_of_power
2:53.451 aoe r arcane_barrage Fluffy_Pillow 12561.8/63371: 20% mana arcane_charge(4), rune_of_power
2:54.757 aoe q arcane_explosion Fluffy_Pillow 16751.9/63371: 26% mana rune_of_power
2:56.063 aoe q arcane_explosion Fluffy_Pillow 13407.2/63371: 21% mana arcane_charge, rune_of_power
2:57.370 aoe q arcane_explosion Fluffy_Pillow 10063.7/63371: 16% mana arcane_charge(2), rune_of_power
2:58.676 aoe q arcane_explosion Fluffy_Pillow 6719.0/63371: 11% mana arcane_charge(3), rune_of_power
2:59.981 aoe r arcane_barrage Fluffy_Pillow 3373.0/63371: 5% mana arcane_charge(4)
3:01.288 aoe q arcane_explosion Fluffy_Pillow 7564.4/63371: 12% mana
3:02.595 aoe s evocation Fluffy_Pillow 4220.9/63371: 7% mana arcane_charge
3:06.940 aoe q arcane_explosion Fluffy_Pillow 58066.8/63371: 92% mana arcane_charge
3:08.247 aoe q arcane_explosion Fluffy_Pillow 54723.4/63371: 86% mana arcane_charge(2), clearcasting
3:09.554 aoe q arcane_explosion Fluffy_Pillow 56379.9/63371: 89% mana arcane_charge(3)
3:10.862 aoe r arcane_barrage Fluffy_Pillow 53037.7/63371: 84% mana arcane_charge(4)
3:12.168 aoe p arcane_orb Fluffy_Pillow 57227.8/63371: 90% mana
3:13.475 aoe r arcane_barrage Fluffy_Pillow 58384.3/63371: 92% mana arcane_charge(4)
3:14.783 aoe q arcane_explosion Fluffy_Pillow 62577.0/63371: 99% mana
3:16.089 aoe q arcane_explosion Fluffy_Pillow 59232.3/63371: 93% mana arcane_charge
3:17.393 aoe q arcane_explosion Fluffy_Pillow 55885.0/63371: 88% mana arcane_charge(2)
3:18.700 aoe q arcane_explosion Fluffy_Pillow 52541.5/63371: 83% mana arcane_charge(3)
3:20.007 aoe r arcane_barrage Fluffy_Pillow 49198.0/63371: 78% mana arcane_charge(4)
3:21.313 aoe q arcane_explosion Fluffy_Pillow 53388.2/63371: 84% mana
3:22.618 aoe q arcane_explosion Fluffy_Pillow 50042.2/63371: 79% mana arcane_charge, clearcasting
3:23.926 aoe q arcane_explosion Fluffy_Pillow 51700.0/63371: 82% mana arcane_charge(2)
3:25.232 aoe q arcane_explosion Fluffy_Pillow 48355.2/63371: 76% mana arcane_charge(3), clearcasting
3:26.539 aoe r arcane_barrage Fluffy_Pillow 50011.7/63371: 79% mana arcane_charge(4)
3:27.846 aoe q arcane_explosion Fluffy_Pillow 54203.1/63371: 86% mana
3:29.152 aoe k touch_of_the_magi Fluffy_Pillow 50858.4/63371: 80% mana arcane_charge
3:30.458 aoe m rune_of_power Fluffy_Pillow 50013.7/63371: 79% mana arcane_charge(4)
3:31.764 aoe r arcane_barrage Fluffy_Pillow 51668.9/63371: 82% mana arcane_charge(4), rune_of_power
3:33.070 aoe p arcane_orb Fluffy_Pillow 55859.0/63371: 88% mana rune_of_power
3:34.375 aoe r arcane_barrage Fluffy_Pillow 57013.0/63371: 90% mana arcane_charge(4), rune_of_power
3:35.683 aoe q arcane_explosion Fluffy_Pillow 61205.7/63371: 97% mana rune_of_power
3:36.988 aoe q arcane_explosion Fluffy_Pillow 57859.7/63371: 91% mana arcane_charge, rune_of_power
3:38.295 aoe q arcane_explosion Fluffy_Pillow 54516.2/63371: 86% mana arcane_charge(2), rune_of_power
3:39.602 aoe q arcane_explosion Fluffy_Pillow 51172.7/63371: 81% mana arcane_charge(3), rune_of_power
3:40.909 aoe r arcane_barrage Fluffy_Pillow 47829.3/63371: 75% mana arcane_charge(4), rune_of_power
3:42.217 aoe q arcane_explosion Fluffy_Pillow 52021.9/63371: 82% mana rune_of_power
3:43.523 aoe q arcane_explosion Fluffy_Pillow 48677.2/63371: 77% mana arcane_charge, rune_of_power
3:44.829 aoe q arcane_explosion Fluffy_Pillow 45332.4/63371: 72% mana arcane_charge(2), rune_of_power
3:46.135 aoe q arcane_explosion Fluffy_Pillow 41987.7/63371: 66% mana arcane_charge(3), rune_of_power
3:47.441 aoe r arcane_barrage Fluffy_Pillow 38643.0/63371: 61% mana arcane_charge(4)
3:48.749 aoe q arcane_explosion Fluffy_Pillow 42835.6/63371: 68% mana
3:50.057 aoe q arcane_explosion Fluffy_Pillow 39493.4/63371: 62% mana arcane_charge, clearcasting
3:51.364 aoe q arcane_explosion Fluffy_Pillow 41149.9/63371: 65% mana arcane_charge(2)
3:52.672 aoe q arcane_explosion Fluffy_Pillow 37807.7/63371: 60% mana arcane_charge(3), clearcasting
3:53.979 aoe r arcane_barrage Fluffy_Pillow 39464.3/63371: 62% mana arcane_charge(4)
3:55.285 aoe p arcane_orb Fluffy_Pillow 43654.4/63371: 69% mana
3:56.591 aoe r arcane_barrage Fluffy_Pillow 44809.7/63371: 71% mana arcane_charge(4)
3:57.897 aoe q arcane_explosion Fluffy_Pillow 48999.8/63371: 77% mana
3:59.204 aoe q arcane_explosion Fluffy_Pillow 45656.3/63371: 72% mana arcane_charge
4:00.511 aoe q arcane_explosion Fluffy_Pillow 42312.8/63371: 67% mana arcane_charge(2)
4:01.818 aoe q arcane_explosion Fluffy_Pillow 38969.4/63371: 61% mana arcane_charge(3)
4:03.124 aoe r arcane_barrage Fluffy_Pillow 35624.6/63371: 56% mana arcane_charge(4), clearcasting
4:04.432 aoe q arcane_explosion Fluffy_Pillow 39817.3/63371: 63% mana clearcasting
4:05.740 shared_cds y use_mana_gem Necrolord_Emeni 41475.1/63371: 65% mana arcane_charge
4:05.740 aoe q arcane_explosion Fluffy_Pillow 47812.2/63371: 75% mana arcane_charge
4:07.047 aoe q arcane_explosion Fluffy_Pillow 44468.7/63371: 70% mana arcane_charge(2)
4:08.354 aoe q arcane_explosion Fluffy_Pillow 41125.3/63371: 65% mana arcane_charge(3), clearcasting
4:09.659 aoe r arcane_barrage Fluffy_Pillow 42779.3/63371: 68% mana arcane_charge(4)
4:10.965 aoe q arcane_explosion Fluffy_Pillow 46969.4/63371: 74% mana
4:12.270 aoe q arcane_explosion Fluffy_Pillow 43623.4/63371: 69% mana arcane_charge, clearcasting
4:13.578 aoe q arcane_explosion Fluffy_Pillow 45281.2/63371: 71% mana arcane_charge(2)
4:14.885 aoe q arcane_explosion Fluffy_Pillow 41937.7/63371: 66% mana arcane_charge(3)
4:16.193 aoe r arcane_barrage Fluffy_Pillow 38595.5/63371: 61% mana arcane_charge(4)
4:17.499 aoe j deathborne Fluffy_Pillow 42785.6/63371: 68% mana
4:18.805 aoe k touch_of_the_magi Fluffy_Pillow 41940.9/63371: 66% mana deathborne, lead_by_example
4:20.112 aoe l arcane_power Fluffy_Pillow 41097.4/63371: 65% mana arcane_charge(4), deathborne, lead_by_example
4:20.112 shared_cds { berserking Fluffy_Pillow 41097.4/63371: 65% mana arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example
4:20.112 aoe o arcane_blast Fluffy_Pillow 41097.4/63371: 65% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example
4:21.322 aoe o arcane_blast Fluffy_Pillow 39193.5/63371: 62% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example
4:22.533 aoe o arcane_blast Fluffy_Pillow 37290.9/63371: 59% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example
4:23.745 aoe o arcane_blast Fluffy_Pillow 35389.5/63371: 56% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example
4:24.957 aoe n presence_of_mind Fluffy_Pillow 33488.1/63371: 53% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example
4:24.957 aoe o arcane_blast Fluffy_Pillow 33488.1/63371: 53% mana berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:26.144 aoe o arcane_blast Fluffy_Pillow 31555.0/63371: 50% mana berserking, arcane_charge(4), arcane_power, presence_of_mind(2), rune_of_power, deathborne, lead_by_example
4:27.333 aoe o arcane_blast Fluffy_Pillow 29624.5/63371: 47% mana berserking, arcane_charge(4), arcane_power, clearcasting, presence_of_mind, rune_of_power, deathborne, lead_by_example
4:28.522 aoe o arcane_blast Fluffy_Pillow 27694.0/63371: 44% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example
4:29.732 aoe o arcane_blast Fluffy_Pillow 25790.1/63371: 41% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example
4:30.944 aoe o arcane_blast Fluffy_Pillow 23888.7/63371: 38% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example
4:32.155 aoe o arcane_blast Fluffy_Pillow 21986.1/63371: 35% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example
4:33.488 aoe o arcane_blast Fluffy_Pillow 20238.0/63371: 32% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example
4:34.820 aoe o arcane_blast Fluffy_Pillow 18488.8/63371: 29% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example
4:36.151 aoe m rune_of_power Fluffy_Pillow 13300.7/63371: 21% mana arcane_charge(4), clearcasting, deathborne, lead_by_example
4:37.457 aoe o arcane_blast Fluffy_Pillow 14956.0/63371: 24% mana arcane_charge(4), clearcasting, rune_of_power, deathborne, lead_by_example
4:38.789 aoe o arcane_blast Fluffy_Pillow 9769.2/63371: 15% mana arcane_charge(4), clearcasting, rune_of_power, deathborne, lead_by_example
4:40.122 aoe r arcane_barrage Fluffy_Pillow 4583.7/63371: 7% mana arcane_charge(4), clearcasting, rune_of_power, lead_by_example
4:41.428 aoe p arcane_orb Fluffy_Pillow 8773.8/63371: 14% mana clearcasting(2), rune_of_power, lead_by_example
4:42.734 aoe r arcane_barrage Fluffy_Pillow 9929.0/63371: 16% mana arcane_charge(4), clearcasting(2), rune_of_power, lead_by_example
4:44.041 aoe q arcane_explosion Fluffy_Pillow 14120.4/63371: 22% mana clearcasting(2), rune_of_power, lead_by_example
4:45.348 aoe q arcane_explosion Fluffy_Pillow 15777.0/63371: 25% mana arcane_charge, clearcasting, rune_of_power, lead_by_example
4:46.655 aoe q arcane_explosion Fluffy_Pillow 17433.5/63371: 28% mana arcane_charge(2), rune_of_power, lead_by_example
4:47.960 aoe q arcane_explosion Fluffy_Pillow 14087.5/63371: 22% mana arcane_charge(3), clearcasting, rune_of_power, lead_by_example
4:49.267 aoe r arcane_barrage Fluffy_Pillow 15744.0/63371: 25% mana arcane_charge(4), rune_of_power
4:50.572 aoe q arcane_explosion Fluffy_Pillow 19932.9/63371: 31% mana rune_of_power
4:51.879 aoe q arcane_explosion Fluffy_Pillow 16589.4/63371: 26% mana arcane_charge, rune_of_power
4:53.185 aoe q arcane_explosion Fluffy_Pillow 13244.7/63371: 21% mana arcane_charge(2), clearcasting
4:54.492 aoe q arcane_explosion Fluffy_Pillow 14901.2/63371: 24% mana arcane_charge(3)
4:55.798 aoe r arcane_barrage Fluffy_Pillow 11556.4/63371: 18% mana arcane_charge(4)
4:57.105 aoe q arcane_explosion Fluffy_Pillow 15747.8/63371: 25% mana
4:58.412 aoe q arcane_explosion Fluffy_Pillow 12404.4/63371: 20% mana arcane_charge, clearcasting
4:59.718 aoe q arcane_explosion Fluffy_Pillow 14059.6/63371: 22% mana arcane_charge(2)
5:01.026 aoe q arcane_explosion Fluffy_Pillow 10717.4/63371: 17% mana arcane_charge(3)
5:02.334 aoe r arcane_barrage Fluffy_Pillow 7375.2/63371: 12% mana arcane_charge(4)
5:03.640 aoe p arcane_orb Fluffy_Pillow 11565.3/63371: 18% mana
5:04.948 aoe r arcane_barrage Fluffy_Pillow 12723.1/63371: 20% mana arcane_charge(4)
5:06.254 aoe q arcane_explosion Fluffy_Pillow 16913.2/63371: 27% mana
5:07.562 aoe q arcane_explosion Fluffy_Pillow 13571.0/63371: 21% mana arcane_charge
5:08.868 aoe q arcane_explosion Fluffy_Pillow 10226.3/63371: 16% mana arcane_charge(2)
5:10.176 aoe q arcane_explosion Fluffy_Pillow 6884.1/63371: 11% mana arcane_charge(3)
5:11.482 aoe r arcane_barrage Fluffy_Pillow 3539.4/63371: 6% mana arcane_charge(4), clearcasting
5:12.789 aoe q arcane_explosion Fluffy_Pillow 7730.7/63371: 12% mana clearcasting
5:14.095 aoe q arcane_explosion Fluffy_Pillow 9386.0/63371: 15% mana arcane_charge
5:15.402 aoe q arcane_explosion Fluffy_Pillow 6042.5/63371: 10% mana arcane_charge(2)
5:16.708 aoe s evocation Fluffy_Pillow 2697.8/63371: 4% mana arcane_charge(3)
5:21.054 aoe q arcane_explosion Fluffy_Pillow 56545.0/63371: 89% mana arcane_charge(3)
5:22.359 aoe r arcane_barrage Fluffy_Pillow 53199.0/63371: 84% mana arcane_charge(4)
5:23.665 aoe k touch_of_the_magi Fluffy_Pillow 57389.1/63371: 91% mana
5:24.971 aoe m rune_of_power Fluffy_Pillow 56544.4/63371: 89% mana arcane_charge(4)
5:26.277 aoe r arcane_barrage Fluffy_Pillow 58199.6/63371: 92% mana arcane_charge(4), rune_of_power
5:27.583 aoe p arcane_orb Fluffy_Pillow 62389.8/63371: 98% mana rune_of_power
5:28.890 aoe r arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(4), rune_of_power
5:30.198 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
5:31.505 aoe q arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge, rune_of_power
5:32.811 aoe q arcane_explosion Fluffy_Pillow 56683.2/63371: 89% mana arcane_charge(2), rune_of_power
5:34.116 aoe q arcane_explosion Fluffy_Pillow 53337.2/63371: 84% mana arcane_charge(3), rune_of_power
5:35.422 aoe r arcane_barrage Fluffy_Pillow 49992.5/63371: 79% mana arcane_charge(4), clearcasting, rune_of_power
5:36.729 aoe q arcane_explosion Fluffy_Pillow 54183.9/63371: 86% mana clearcasting, rune_of_power
5:38.035 aoe q arcane_explosion Fluffy_Pillow 55839.1/63371: 88% mana arcane_charge, rune_of_power
5:39.342 aoe q arcane_explosion Fluffy_Pillow 52495.7/63371: 83% mana arcane_charge(2), rune_of_power
5:40.648 aoe q arcane_explosion Fluffy_Pillow 49150.9/63371: 78% mana arcane_charge(3), clearcasting, rune_of_power
5:41.954 aoe r arcane_barrage Fluffy_Pillow 50806.2/63371: 80% mana arcane_charge(4)
5:43.261 aoe q arcane_explosion Fluffy_Pillow 54997.6/63371: 87% mana
5:44.567 aoe q arcane_explosion Fluffy_Pillow 51652.8/63371: 82% mana arcane_charge, clearcasting
5:45.871 aoe q arcane_explosion Fluffy_Pillow 53305.6/63371: 84% mana arcane_charge(2)
5:47.178 aoe q arcane_explosion Fluffy_Pillow 49962.1/63371: 79% mana arcane_charge(3)
5:48.484 aoe r arcane_barrage Fluffy_Pillow 46617.3/63371: 74% mana arcane_charge(4), clearcasting
5:49.792 aoe p arcane_orb Fluffy_Pillow 50810.0/63371: 80% mana clearcasting
5:51.098 aoe r arcane_barrage Fluffy_Pillow 51965.3/63371: 82% mana arcane_charge(4), clearcasting
5:52.405 aoe q arcane_explosion Fluffy_Pillow 56156.6/63371: 89% mana clearcasting
5:53.710 aoe q arcane_explosion Fluffy_Pillow 57810.6/63371: 91% mana arcane_charge
5:55.017 aoe q arcane_explosion Fluffy_Pillow 54467.2/63371: 86% mana arcane_charge(2)
5:56.325 aoe q arcane_explosion Fluffy_Pillow 51125.0/63371: 81% mana arcane_charge(3)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Necrolord_Emeni"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=necrolord
soulbind=342156//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Necrolord_Marileth : 10787 dps, 4582 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
10786.6 10786.6 17.7 / 0.164% 1291.7 / 12.0% 5.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
2173.1 2062.8 Mana 0.00% 49.2 100.0% 100%
Talents
Necrolord

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necrolord_Marileth 10787
Arcane Barrage 2248 20.8% 49.8 5.62sec 13581 10627 Direct 149.1 3798 7603 4534 19.4%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 49.78 149.11 0.00 0.00 1.2780 0.0000 676080.97 676080.97 0.00% 10626.53 10626.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 120.26 89 154 3797.68 1153 12023 3797.66 3434 4144 456648 456648 0.00%
crit 19.35% 28.85 12 47 7602.64 2307 24047 7615.89 5354 10433 219433 219433 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [r]:49.58
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
    rotation
    [u]:0.00
  • if_expr:cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
    rotation
    [x]:0.18
Arcane Blast 2687 25.0% 29.7 7.95sec 27378 25500 Direct 85.8 7948 15879 9472 19.2%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.69 85.81 0.00 0.00 1.0736 0.0000 812840.95 812840.95 0.00% 25500.09 25500.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 69.31 35 91 7947.68 841 12036 7953.30 6595 8516 550788 550788 0.00%
crit 19.23% 16.50 3 33 15878.56 1682 24073 15880.76 10810 20482 262053 262053 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r

Action Priority List

    aoe
    [o]:29.78
  • if_expr:buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
    rotation
    [w]:0.11
Arcane Echo 249 2.3% 37.9 7.59sec 1975 0 Direct 113.7 552 1103 658 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.92 113.75 0.00 0.00 0.0000 0.0000 74876.65 74876.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.71% 91.81 62 123 552.16 443 731 551.67 508 590 50682 50682 0.00%
crit 19.29% 21.94 8 41 1102.76 886 1462 1101.89 913 1312 24195 24195 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 3967 36.7% 129.6 2.11sec 9200 7207 Direct 388.7 2570 5145 3067 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 129.55 388.65 0.00 0.00 1.2765 0.0000 1191841.33 1191841.33 0.00% 7207.12 7207.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 313.64 247 393 2569.78 2128 4469 2571.00 2484 2665 805956 805956 0.00%
crit 19.30% 75.01 45 115 5144.96 4256 8938 5146.27 4731 5605 385886 385886 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.546000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 54.6%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [q]:129.52
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (687) 0.0% (6.4%) 11.6 24.98sec 17871 13956

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.55 0.00 0.00 0.00 1.2805 0.0000 0.00 0.00 0.00% 13956.16 13956.16

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [p]:11.54
  • if_expr:buff.arcane_charge.stack=0
    rotation
    [v]:0.01
  • if_expr:buff.arcane_charge.stack<=variable.totm_max_charges
    Arcane Orb (_bolt) 687 6.4% 34.6 24.99sec 5966 0 Direct 34.6 5007 10033 5967 19.1%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.61 34.61 0.00 0.00 0.0000 0.0000 206481.39 206481.39 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.91% 28.00 17 40 5006.90 3869 8126 5013.76 4314 5436 140216 140216 0.00%
crit 19.09% 6.61 0 17 10033.06 7739 16251 10034.74 0 16251 66266 66266 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (64) 0.0% (0.6%) 13.7 1.81sec 1387 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.66 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 64 0.6% 13.7 1.81sec 1387 0 Direct 13.7 1164 2327 1387 19.2%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.66 13.66 0.00 0.00 0.0000 0.0000 18942.72 18942.72 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.81% 11.04 5 18 1163.53 1164 1164 1163.53 1164 1164 12843 12843 0.00%
crit 19.19% 2.62 0 9 2327.06 2327 2327 2180.38 0 2327 6100 6100 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1762 19.1%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1763.59 1763.59 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.89% 0.81 0 1 1480.68 1481 1481 1197.76 0 1481 1198 1198 0.00%
crit 19.11% 0.19 0 1 2961.35 2961 2961 565.83 0 2961 566 566 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 6034 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 151  / 20 0.2% 90.0 1.29sec 67 51 Direct 90.0 56 113 67 19.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6033.81 6033.81 0.00% 51.23 51.23
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 72.71 61 84 56.21 43 60 56.21 55 58 4087 4087 0.00%
crit 19.22% 17.29 6 29 112.59 86 120 112.63 102 120 1947 1947 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (860) 0.0% (8.0%) 6.1 52.52sec 42191 33551

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.14 0.00 0.00 0.00 1.2576 0.0000 0.00 0.00 0.00% 33550.53 33550.53

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.16
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 860 8.0% 6.1 52.42sec 42191 0 Direct 18.3 14142 0 14142 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.14 18.33 0.00 0.00 0.0000 0.0000 259077.16 259077.16 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.33 15 21 14141.57 1517 64368 14112.18 9975 18596 259077 259077 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24011.07
  • base_dd_max:24011.07
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Necrolord_Marileth
Arcane Power 2.8 129.48sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.84
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 258.89sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [{]:1.84
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Deathborne 1.8 258.94sec

Stats Details: Deathborne

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.84 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathborne

  • id:324220
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:324220
  • name:Deathborne
  • school:shadow
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.

Action Priority List

    aoe
    [j]:1.86
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Evocation 2.0 182.01sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.04 0.00 12.14 0.00 4.0198 0.6741 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Marileth
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [s]:2.04
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Marileth
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Marileth
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [z]:1.00
  • if_expr:buff.arcane_power.up
Presence of Mind 1.8 257.76sec

Stats Details: Presence Of Mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Presence Of Mind

  • id:205025
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:205025
  • name:Presence of Mind
  • school:arcane
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.

Action Priority List

    aoe
    [n]:1.80
  • if_expr:buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
    cooldowns
    [t]:0.00
  • if_expr:debuff.touch_of_the_magi.up&!covenant.kyrian.enabled
Rune of Power 6.0 51.00sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.98 0.00 0.00 0.00 1.2563 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:6.00
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 3.0 120.87sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Marileth
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [y]:2.95
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 50.6 161.0 5.9sec 1.4sec 4.5sec 75.65% 0.00% 28.9 (29.0) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.0s / 30.9s
  • trigger_min/max:0.0s / 8.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 29.6s

Stack Uptimes

  • arcane_charge_1:16.86%
  • arcane_charge_2:14.78%
  • arcane_charge_3:14.90%
  • arcane_charge_4:29.11%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 129.4sec 129.4sec 14.7sec 13.80% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.5s / 139.5s
  • trigger_min/max:121.5s / 139.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:13.80%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 258.7sec 258.7sec 11.7sec 7.06% 32.55% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:253.3s / 267.9s
  • trigger_min/max:253.3s / 267.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:7.06%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.46% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.46%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.6 3.4 13.1sec 11.3sec 3.2sec 23.79% 0.00% 1.0 (1.0) 0.3

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:17.82%
  • clearcasting_2:2.97%
  • clearcasting_3:3.00%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Deathborne 1.8 0.0 258.8sec 258.8sec 19.1sec 11.58% 0.00% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_deathborne
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:254.3s / 267.6s
  • trigger_min/max:254.3s / 267.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • deathborne_1:11.58%

Spelldata

  • id:324220
  • name:Deathborne
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Evocation 2.0 0.0 173.1sec 173.1sec 4.0sec 2.71% 0.00% 8.1 (8.1) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:90.0s / 300.0s
  • trigger_min/max:90.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:2.71%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.41% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.41%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Presence of Mind 1.8 0.0 256.9sec 256.9sec 2.4sec 1.43% 17.96% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_presence_of_mind
  • max_stacks:3
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:110.6s / 267.1s
  • trigger_min/max:110.6s / 267.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 145.3s

Stack Uptimes

  • presence_of_mind_1:0.61%
  • presence_of_mind_2:0.62%
  • presence_of_mind_3:0.19%

Spelldata

  • id:205025
  • name:Presence of Mind
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.
  • max_stacks:0
  • duration:-0.00
  • cooldown:60.00
  • default_chance:100.00%
Rune of Power 8.8 0.0 35.5sec 35.5sec 14.7sec 42.92% 0.00% 0.0 (0.0) 8.4

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.7s / 54.0s
  • trigger_min/max:15.7s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:42.92%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 1 0.05% 0.00% 3.64%
Arcane Barrage Arcane Charge 2 0.12% 0.00% 7.55%
Arcane Barrage Arcane Charge 3 0.17% 0.00% 6.00%
Arcane Barrage Arcane Charge 4 99.66% 87.93% 100.00%
Arcane Blast Arcane Charge 0 1.21% 0.00% 7.41%
Arcane Blast Arcane Charge 1 1.13% 0.00% 8.11%
Arcane Blast Arcane Charge 2 1.01% 0.00% 6.67%
Arcane Blast Arcane Charge 3 0.62% 0.00% 6.67%
Arcane Blast Arcane Charge 4 96.03% 73.33% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 0.49% 0.14% 3.93% 0.7s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 301.2s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000181.223120.154239.984
Evocation63.3090.000210.002152.45165.166261.048
Rune of Power6.8860.00050.10942.92223.13577.352
Touch of the Magi5.4240.00027.76535.16321.80970.949
Arcane Power6.9101.50619.50919.9318.34330.184
Arcane Barrage3.4640.00228.292174.896133.571210.999
Arcane Orb6.5490.00034.53077.84349.358100.128
Deathborne35.4860.00086.27176.19758.85286.271
Presence of Mind91.2227.899205.292205.04756.648235.776

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necrolord_Marileth
mana_regen Mana 823.94 378916.71 60.99% 459.89 2272.56 0.60%
Evocation Mana 91.30 98541.38 15.86% 1079.26 0.00 0.00%
Mana Gem Mana 2.95 18698.48 3.01% 6337.14 0.00 0.00%
Arcane Barrage Mana 49.77 125096.25 20.14% 2513.59 865.48 0.69%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 2062.81 2173.05 3127.4 30164.9 188.1 63371.4
Usage Type Count Total Avg RPE APR
Necrolord_Marileth
arcane_blast Mana 29.7 119059.5 4004.7 4010.1 6.8
arcane_explosion Mana 129.5 509041.6 3930.1 3929.3 2.3
arcane_orb Mana 11.6 5525.2 478.4 478.2 37.4
deathborne Mana 1.8 4610.1 2500.0 2502.2 0.0
touch_of_the_magi Mana 6.1 15347.6 2500.0 2499.4 16.9

Statistics & Data Analysis

Fight Length
Necrolord_Marileth Fight Length
Count 1523
Mean 301.22
Minimum 240.15
Maximum 359.98
Spread ( max - min ) 119.83
Range [ ( max - min ) / 2 * 100% ] 19.89%
DPS
Necrolord_Marileth Damage Per Second
Count 1523
Mean 10786.58
Minimum 9907.52
Maximum 11784.41
Spread ( max - min ) 1876.89
Range [ ( max - min ) / 2 * 100% ] 8.70%
Standard Deviation 352.4177
5th Percentile 10235.12
95th Percentile 11382.75
( 95th Percentile - 5th Percentile ) 1147.63
Mean Distribution
Standard Deviation 9.0304
95.00% Confidence Interval ( 10768.88 - 10804.28 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4101
0.1 Scale Factor Error with Delta=300 1061
0.05 Scale Factor Error with Delta=300 4241
0.01 Scale Factor Error with Delta=300 106023
Priority Target DPS
Necrolord_Marileth Priority Target Damage Per Second
Count 1523
Mean 4582.39
Minimum 3945.35
Maximum 5167.26
Spread ( max - min ) 1221.90
Range [ ( max - min ) / 2 * 100% ] 13.33%
Standard Deviation 196.0968
5th Percentile 4272.88
95th Percentile 4911.76
( 95th Percentile - 5th Percentile ) 638.88
Mean Distribution
Standard Deviation 5.0248
95.00% Confidence Interval ( 4572.54 - 4592.23 )
Normalized 95.00% Confidence Interval ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 71
0.1% Error 7035
0.1 Scale Factor Error with Delta=300 329
0.05 Scale Factor Error with Delta=300 1314
0.01 Scale Factor Error with Delta=300 32827
DPS(e)
Necrolord_Marileth Damage Per Second (Effective)
Count 1523
Mean 10786.58
Minimum 9907.52
Maximum 11784.41
Spread ( max - min ) 1876.89
Range [ ( max - min ) / 2 * 100% ] 8.70%
Damage
Necrolord_Marileth Damage
Count 1523
Mean 3241904.75
Minimum 2446935.82
Maximum 3924436.87
Spread ( max - min ) 1477501.05
Range [ ( max - min ) / 2 * 100% ] 22.79%
DTPS
Necrolord_Marileth Damage Taken Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necrolord_Marileth Healing Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necrolord_Marileth Healing Per Second (Effective)
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necrolord_Marileth Heal
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necrolord_Marileth Healing Taken Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necrolord_Marileth Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Necrolord_MarilethTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necrolord_Marileth Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 1.86 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.16 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.84 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 6.00 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
n 1.80 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
o 29.78 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
p 11.54 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
q 129.52 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
r 49.58 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
s 2.04 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation
# count action,conditions
0.00 variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
u 0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
0.00 strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
0.00 arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
0.00 arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
0.00 arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
0.00 arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
0.00 arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
v 0.01 arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
0.00 supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
0.00 arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
w 0.11 arcane_blast
0.00 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
x 0.18 arcane_barrage
actions.shared_cds
# count action,conditions
y 2.95 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
z 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
{ 1.84 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjklz{oooyooonoooooooooomooorprqqqqrqqqqrqqqqrqsqqqrprqqqqrqqqqrkmrqqqqrprqqqqrqqqqrqqqqrprqqqqrqqqqrkmrqqqqrpyrqqqqlrqqqqrqqqqrprqqqqrqqqqrkmrqqqqrprqqqqrqqqqrqqqqrprqqqqrqqqqrkmrqqqqrprqqqqrqqqqrqqqqrpryqqqqrqqqqrjkl{oooonoooroooomorprqqqsqrqqqqrprqqqqrqqqqrqqqqrkmrprqqqqrqqqqrqqqqrprqqqq

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Necrolord_Marileth 63371.4/63371: 100% mana
Pre precombat R food Necrolord_Marileth 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j deathborne Fluffy_Pillow 62371.4/63371: 98% mana
0:01.305 aoe k touch_of_the_magi Fluffy_Pillow 60875.2/63371: 96% mana bloodlust, deathborne
0:02.311 aoe l arcane_power Fluffy_Pillow 59650.3/63371: 94% mana bloodlust, arcane_charge(4), deathborne
0:02.311 shared_cds z potion Fluffy_Pillow 59650.3/63371: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne
0:02.311 shared_cds { berserking Fluffy_Pillow 59650.3/63371: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:02.311 aoe o arcane_blast Fluffy_Pillow 59650.3/63371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:03.241 aoe o arcane_blast Fluffy_Pillow 57391.5/63371: 91% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:04.172 aoe o arcane_blast Fluffy_Pillow 55133.9/63371: 87% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:05.104 shared_cds y use_mana_gem Necrolord_Marileth 52877.7/63371: 83% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:05.104 aoe o arcane_blast Fluffy_Pillow 59214.8/63371: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:06.036 aoe o arcane_blast Fluffy_Pillow 56958.6/63371: 90% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:06.969 aoe o arcane_blast Fluffy_Pillow 54703.6/63371: 86% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:07.902 aoe n presence_of_mind Fluffy_Pillow 52448.6/63371: 83% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:07.902 aoe o arcane_blast Fluffy_Pillow 52448.6/63371: 83% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:08.817 aoe o arcane_blast Fluffy_Pillow 50170.8/63371: 79% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind(2), rune_of_power, deathborne, potion_of_deathly_fixation
0:09.731 aoe o arcane_blast Fluffy_Pillow 47891.7/63371: 76% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind, rune_of_power, deathborne, potion_of_deathly_fixation
0:10.648 aoe o arcane_blast Fluffy_Pillow 45616.5/63371: 72% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:11.580 aoe o arcane_blast Fluffy_Pillow 43360.2/63371: 68% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:12.512 aoe o arcane_blast Fluffy_Pillow 41103.9/63371: 65% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:13.443 aoe o arcane_blast Fluffy_Pillow 38846.4/63371: 61% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:14.377 aoe o arcane_blast Fluffy_Pillow 36592.7/63371: 58% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:15.403 aoe o arcane_blast Fluffy_Pillow 34455.6/63371: 54% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:16.429 aoe o arcane_blast Fluffy_Pillow 32318.5/63371: 51% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:17.455 aoe m rune_of_power Fluffy_Pillow 26743.8/63371: 42% mana bloodlust, arcane_charge(4), clearcasting, deathborne, potion_of_deathly_fixation
0:18.462 aoe o arcane_blast Fluffy_Pillow 28020.1/63371: 44% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, deathborne, potion_of_deathly_fixation
0:19.489 aoe o arcane_blast Fluffy_Pillow 22446.8/63371: 35% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, deathborne, potion_of_deathly_fixation
0:20.516 aoe o arcane_blast Fluffy_Pillow 16873.4/63371: 27% mana bloodlust, arcane_charge(4), clearcasting(2), rune_of_power, deathborne, potion_of_deathly_fixation
0:21.542 aoe r arcane_barrage Fluffy_Pillow 11298.8/63371: 18% mana bloodlust, arcane_charge(4), clearcasting(2), rune_of_power, potion_of_deathly_fixation
0:22.546 aoe p arcane_orb Fluffy_Pillow 15106.2/63371: 24% mana bloodlust, clearcasting(2), rune_of_power, potion_of_deathly_fixation
0:23.551 aoe r arcane_barrage Fluffy_Pillow 15879.9/63371: 25% mana bloodlust, arcane_charge(4), clearcasting(2), rune_of_power, potion_of_deathly_fixation
0:24.557 aoe q arcane_explosion Fluffy_Pillow 19689.8/63371: 31% mana bloodlust, clearcasting(2), rune_of_power, potion_of_deathly_fixation
0:25.563 aoe q arcane_explosion Fluffy_Pillow 20964.9/63371: 33% mana bloodlust, arcane_charge, clearcasting, rune_of_power, potion_of_deathly_fixation
0:26.568 aoe q arcane_explosion Fluffy_Pillow 22238.6/63371: 35% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:27.575 aoe q arcane_explosion Fluffy_Pillow 18514.9/63371: 29% mana bloodlust, arcane_charge(3), rune_of_power
0:28.580 aoe r arcane_barrage Fluffy_Pillow 14788.7/63371: 23% mana bloodlust, arcane_charge(4), rune_of_power
0:29.587 aoe q arcane_explosion Fluffy_Pillow 18599.9/63371: 29% mana bloodlust, rune_of_power
0:30.594 aoe q arcane_explosion Fluffy_Pillow 14876.2/63371: 23% mana bloodlust, arcane_charge, clearcasting, rune_of_power
0:31.599 aoe q arcane_explosion Fluffy_Pillow 16149.9/63371: 25% mana bloodlust, arcane_charge(2), rune_of_power
0:32.605 aoe q arcane_explosion Fluffy_Pillow 12425.0/63371: 20% mana bloodlust, arcane_charge(3), rune_of_power
0:33.610 aoe r arcane_barrage Fluffy_Pillow 8698.7/63371: 14% mana bloodlust, arcane_charge(4)
0:34.616 aoe q arcane_explosion Fluffy_Pillow 12508.6/63371: 20% mana bloodlust
0:35.623 aoe q arcane_explosion Fluffy_Pillow 8784.9/63371: 14% mana bloodlust, arcane_charge
0:36.629 aoe q arcane_explosion Fluffy_Pillow 5059.9/63371: 8% mana bloodlust, arcane_charge(2), clearcasting
0:37.634 aoe q arcane_explosion Fluffy_Pillow 6333.7/63371: 10% mana bloodlust, arcane_charge(3)
0:38.642 aoe r arcane_barrage Fluffy_Pillow 2611.3/63371: 4% mana bloodlust, arcane_charge(4)
0:39.647 aoe q arcane_explosion Fluffy_Pillow 6419.9/63371: 10% mana bloodlust
0:40.654 aoe s evocation Necrolord_Marileth 2696.2/63371: 4% mana bloodlust, arcane_charge
0:43.999 aoe q arcane_explosion Fluffy_Pillow 56567.0/63371: 89% mana arcane_charge
0:45.305 aoe q arcane_explosion Fluffy_Pillow 53222.2/63371: 84% mana arcane_charge(2)
0:46.613 aoe q arcane_explosion Fluffy_Pillow 49880.0/63371: 79% mana arcane_charge(3), clearcasting
0:47.919 aoe r arcane_barrage Fluffy_Pillow 51535.3/63371: 81% mana arcane_charge(4)
0:49.225 aoe p arcane_orb Fluffy_Pillow 55725.4/63371: 88% mana
0:50.530 aoe r arcane_barrage Fluffy_Pillow 56879.4/63371: 90% mana arcane_charge(4)
0:51.835 aoe q arcane_explosion Fluffy_Pillow 61068.2/63371: 96% mana
0:53.142 aoe q arcane_explosion Fluffy_Pillow 57724.8/63371: 91% mana arcane_charge
0:54.447 aoe q arcane_explosion Fluffy_Pillow 54378.8/63371: 86% mana arcane_charge(2)
0:55.753 aoe q arcane_explosion Fluffy_Pillow 51034.0/63371: 81% mana arcane_charge(3)
0:57.059 aoe r arcane_barrage Fluffy_Pillow 47689.3/63371: 75% mana arcane_charge(4)
0:58.366 aoe q arcane_explosion Fluffy_Pillow 51880.7/63371: 82% mana
0:59.672 aoe q arcane_explosion Fluffy_Pillow 48535.9/63371: 77% mana arcane_charge
1:00.977 aoe q arcane_explosion Fluffy_Pillow 45189.9/63371: 71% mana arcane_charge(2), clearcasting
1:02.283 aoe q arcane_explosion Fluffy_Pillow 46845.2/63371: 74% mana arcane_charge(3)
1:03.590 aoe r arcane_barrage Fluffy_Pillow 43501.7/63371: 69% mana arcane_charge(4)
1:04.898 aoe k touch_of_the_magi Fluffy_Pillow 47694.4/63371: 75% mana
1:06.204 aoe m rune_of_power Fluffy_Pillow 46849.6/63371: 74% mana arcane_charge(4), clearcasting
1:07.511 aoe r arcane_barrage Fluffy_Pillow 48506.2/63371: 77% mana arcane_charge(4), clearcasting, rune_of_power
1:08.818 aoe q arcane_explosion Fluffy_Pillow 52697.5/63371: 83% mana clearcasting, rune_of_power
1:10.124 aoe q arcane_explosion Fluffy_Pillow 54352.8/63371: 86% mana arcane_charge, rune_of_power
1:11.430 aoe q arcane_explosion Fluffy_Pillow 51008.1/63371: 80% mana arcane_charge(2), clearcasting, rune_of_power
1:12.736 aoe q arcane_explosion Fluffy_Pillow 52663.3/63371: 83% mana arcane_charge(3), rune_of_power
1:14.042 aoe r arcane_barrage Fluffy_Pillow 49318.6/63371: 78% mana arcane_charge(4), rune_of_power
1:15.350 aoe p arcane_orb Fluffy_Pillow 53511.2/63371: 84% mana rune_of_power
1:16.656 aoe r arcane_barrage Fluffy_Pillow 54666.5/63371: 86% mana arcane_charge(4), rune_of_power
1:17.961 aoe q arcane_explosion Fluffy_Pillow 58855.4/63371: 93% mana rune_of_power
1:19.267 aoe q arcane_explosion Fluffy_Pillow 55510.6/63371: 88% mana arcane_charge, rune_of_power
1:20.575 aoe q arcane_explosion Fluffy_Pillow 52168.4/63371: 82% mana arcane_charge(2), rune_of_power
1:21.883 aoe q arcane_explosion Fluffy_Pillow 48826.2/63371: 77% mana arcane_charge(3), rune_of_power
1:23.192 aoe r arcane_barrage Fluffy_Pillow 45485.3/63371: 72% mana arcane_charge(4), clearcasting
1:24.499 aoe q arcane_explosion Fluffy_Pillow 49676.7/63371: 78% mana clearcasting
1:25.804 aoe q arcane_explosion Fluffy_Pillow 51330.7/63371: 81% mana arcane_charge
1:27.110 aoe q arcane_explosion Fluffy_Pillow 47985.9/63371: 76% mana arcane_charge(2)
1:28.418 aoe q arcane_explosion Fluffy_Pillow 44643.7/63371: 70% mana arcane_charge(3)
1:29.724 aoe r arcane_barrage Fluffy_Pillow 41299.0/63371: 65% mana arcane_charge(4)
1:31.032 aoe q arcane_explosion Fluffy_Pillow 45491.6/63371: 72% mana
1:32.338 aoe q arcane_explosion Fluffy_Pillow 42146.9/63371: 67% mana arcane_charge
1:33.645 aoe q arcane_explosion Fluffy_Pillow 38803.4/63371: 61% mana arcane_charge(2)
1:34.952 aoe q arcane_explosion Fluffy_Pillow 35460.0/63371: 56% mana arcane_charge(3), clearcasting
1:36.258 aoe r arcane_barrage Fluffy_Pillow 37115.2/63371: 59% mana arcane_charge(4)
1:37.564 aoe p arcane_orb Fluffy_Pillow 41305.3/63371: 65% mana
1:38.871 aoe r arcane_barrage Fluffy_Pillow 42461.9/63371: 67% mana arcane_charge(4)
1:40.179 aoe q arcane_explosion Fluffy_Pillow 46654.5/63371: 74% mana
1:41.487 aoe q arcane_explosion Fluffy_Pillow 43312.3/63371: 68% mana arcane_charge
1:42.791 aoe q arcane_explosion Fluffy_Pillow 39965.0/63371: 63% mana arcane_charge(2)
1:44.098 aoe q arcane_explosion Fluffy_Pillow 36621.6/63371: 58% mana arcane_charge(3)
1:45.406 aoe r arcane_barrage Fluffy_Pillow 33279.4/63371: 53% mana arcane_charge(4)
1:46.713 aoe q arcane_explosion Fluffy_Pillow 37470.8/63371: 59% mana
1:48.020 aoe q arcane_explosion Fluffy_Pillow 34127.3/63371: 54% mana arcane_charge
1:49.327 aoe q arcane_explosion Fluffy_Pillow 30783.8/63371: 49% mana arcane_charge(2)
1:50.633 aoe q arcane_explosion Fluffy_Pillow 27439.1/63371: 43% mana arcane_charge(3)
1:51.940 aoe r arcane_barrage Fluffy_Pillow 24095.6/63371: 38% mana arcane_charge(4)
1:53.244 aoe k touch_of_the_magi Fluffy_Pillow 28283.2/63371: 45% mana
1:54.550 aoe m rune_of_power Fluffy_Pillow 27438.4/63371: 43% mana arcane_charge(4)
1:55.856 aoe r arcane_barrage Fluffy_Pillow 29093.7/63371: 46% mana arcane_charge(4), rune_of_power
1:57.164 aoe q arcane_explosion Fluffy_Pillow 33286.4/63371: 53% mana rune_of_power
1:58.471 aoe q arcane_explosion Fluffy_Pillow 29942.9/63371: 47% mana arcane_charge, clearcasting, rune_of_power
1:59.780 aoe q arcane_explosion Fluffy_Pillow 31602.0/63371: 50% mana arcane_charge(2), rune_of_power
2:01.088 aoe q arcane_explosion Fluffy_Pillow 28259.8/63371: 45% mana arcane_charge(3), rune_of_power
2:02.395 aoe r arcane_barrage Fluffy_Pillow 24916.3/63371: 39% mana arcane_charge(4), rune_of_power
2:03.701 aoe p arcane_orb Fluffy_Pillow 29106.4/63371: 46% mana rune_of_power
2:05.008 shared_cds y use_mana_gem Necrolord_Marileth 30262.9/63371: 48% mana arcane_charge(4), rune_of_power
2:05.104 aoe r arcane_barrage Fluffy_Pillow 36721.7/63371: 58% mana arcane_charge(4), rune_of_power
2:06.412 aoe q arcane_explosion Fluffy_Pillow 40914.4/63371: 65% mana rune_of_power
2:07.718 aoe q arcane_explosion Fluffy_Pillow 37569.7/63371: 59% mana arcane_charge, clearcasting, rune_of_power
2:09.024 aoe q arcane_explosion Fluffy_Pillow 39224.9/63371: 62% mana arcane_charge(2), rune_of_power
2:10.331 aoe q arcane_explosion Fluffy_Pillow 35881.5/63371: 57% mana arcane_charge(3), rune_of_power
2:11.637 aoe l arcane_power Fluffy_Pillow 32536.7/63371: 51% mana arcane_charge(4)
2:11.637 aoe r arcane_barrage Fluffy_Pillow 32536.7/63371: 51% mana arcane_charge(4), arcane_power, rune_of_power
2:12.943 aoe q arcane_explosion Fluffy_Pillow 36726.8/63371: 58% mana arcane_power, rune_of_power
2:14.250 aoe q arcane_explosion Fluffy_Pillow 35883.4/63371: 57% mana arcane_charge, arcane_power, rune_of_power
2:15.557 aoe q arcane_explosion Fluffy_Pillow 35039.9/63371: 55% mana arcane_charge(2), arcane_power, rune_of_power
2:16.865 aoe q arcane_explosion Fluffy_Pillow 34197.7/63371: 54% mana arcane_charge(3), arcane_power, rune_of_power
2:18.173 aoe r arcane_barrage Fluffy_Pillow 33355.5/63371: 53% mana arcane_charge(4), arcane_power, rune_of_power
2:19.481 aoe q arcane_explosion Fluffy_Pillow 37548.1/63371: 59% mana arcane_power, rune_of_power
2:20.788 aoe q arcane_explosion Fluffy_Pillow 36704.7/63371: 58% mana arcane_charge, arcane_power, rune_of_power
2:22.095 aoe q arcane_explosion Fluffy_Pillow 35861.2/63371: 57% mana arcane_charge(2), arcane_power, rune_of_power
2:23.400 aoe q arcane_explosion Fluffy_Pillow 35015.2/63371: 55% mana arcane_charge(3), arcane_power, rune_of_power
2:24.706 aoe r arcane_barrage Fluffy_Pillow 34170.5/63371: 54% mana arcane_charge(4), arcane_power, rune_of_power
2:26.012 aoe p arcane_orb Fluffy_Pillow 38360.6/63371: 61% mana arcane_power, rune_of_power
2:27.321 aoe r arcane_barrage Fluffy_Pillow 39769.6/63371: 63% mana arcane_charge(4)
2:28.627 aoe q arcane_explosion Fluffy_Pillow 43959.8/63371: 69% mana
2:29.933 aoe q arcane_explosion Fluffy_Pillow 40615.0/63371: 64% mana arcane_charge
2:31.239 aoe q arcane_explosion Fluffy_Pillow 37270.3/63371: 59% mana arcane_charge(2)
2:32.545 aoe q arcane_explosion Fluffy_Pillow 33925.5/63371: 54% mana arcane_charge(3), clearcasting
2:33.851 aoe r arcane_barrage Fluffy_Pillow 35580.8/63371: 56% mana arcane_charge(4)
2:35.158 aoe q arcane_explosion Fluffy_Pillow 39772.2/63371: 63% mana
2:36.465 aoe q arcane_explosion Fluffy_Pillow 36428.7/63371: 57% mana arcane_charge, clearcasting
2:37.770 aoe q arcane_explosion Fluffy_Pillow 38082.7/63371: 60% mana arcane_charge(2)
2:39.076 aoe q arcane_explosion Fluffy_Pillow 34738.0/63371: 55% mana arcane_charge(3), clearcasting
2:40.382 aoe r arcane_barrage Fluffy_Pillow 36393.2/63371: 57% mana arcane_charge(4)
2:41.689 aoe k touch_of_the_magi Fluffy_Pillow 40584.6/63371: 64% mana
2:42.994 aoe m rune_of_power Fluffy_Pillow 39738.6/63371: 63% mana arcane_charge(4)
2:44.299 aoe r arcane_barrage Fluffy_Pillow 41392.6/63371: 65% mana arcane_charge(4), rune_of_power
2:45.605 aoe q arcane_explosion Fluffy_Pillow 45582.7/63371: 72% mana rune_of_power
2:46.911 aoe q arcane_explosion Fluffy_Pillow 42238.0/63371: 67% mana arcane_charge, clearcasting, rune_of_power
2:48.218 aoe q arcane_explosion Fluffy_Pillow 43894.5/63371: 69% mana arcane_charge(2), rune_of_power
2:49.526 aoe q arcane_explosion Fluffy_Pillow 40552.3/63371: 64% mana arcane_charge(3), clearcasting, rune_of_power
2:50.834 aoe r arcane_barrage Fluffy_Pillow 42210.1/63371: 67% mana arcane_charge(4), rune_of_power
2:52.140 aoe p arcane_orb Fluffy_Pillow 46400.2/63371: 73% mana rune_of_power
2:53.447 aoe r arcane_barrage Fluffy_Pillow 47556.8/63371: 75% mana arcane_charge(4), rune_of_power
2:54.754 aoe q arcane_explosion Fluffy_Pillow 51748.1/63371: 82% mana rune_of_power
2:56.058 aoe q arcane_explosion Fluffy_Pillow 48400.9/63371: 76% mana arcane_charge, clearcasting, rune_of_power
2:57.365 aoe q arcane_explosion Fluffy_Pillow 50057.4/63371: 79% mana arcane_charge(2), rune_of_power
2:58.672 aoe q arcane_explosion Fluffy_Pillow 46713.9/63371: 74% mana arcane_charge(3), rune_of_power
2:59.978 aoe r arcane_barrage Fluffy_Pillow 43369.2/63371: 68% mana arcane_charge(4), clearcasting
3:01.282 aoe q arcane_explosion Fluffy_Pillow 47556.8/63371: 75% mana clearcasting
3:02.589 aoe q arcane_explosion Fluffy_Pillow 49213.3/63371: 78% mana arcane_charge
3:03.895 aoe q arcane_explosion Fluffy_Pillow 45868.6/63371: 72% mana arcane_charge(2)
3:05.202 aoe q arcane_explosion Fluffy_Pillow 42525.1/63371: 67% mana arcane_charge(3)
3:06.509 aoe r arcane_barrage Fluffy_Pillow 39181.6/63371: 62% mana arcane_charge(4)
3:07.814 aoe q arcane_explosion Fluffy_Pillow 43370.5/63371: 68% mana
3:09.121 aoe q arcane_explosion Fluffy_Pillow 40027.0/63371: 63% mana arcane_charge
3:10.427 aoe q arcane_explosion Fluffy_Pillow 36682.3/63371: 58% mana arcane_charge(2), clearcasting
3:11.734 aoe q arcane_explosion Fluffy_Pillow 38338.8/63371: 60% mana arcane_charge(3)
3:13.041 aoe r arcane_barrage Fluffy_Pillow 34995.3/63371: 55% mana arcane_charge(4)
3:14.349 aoe p arcane_orb Fluffy_Pillow 39188.0/63371: 62% mana
3:15.657 aoe r arcane_barrage Fluffy_Pillow 40345.8/63371: 64% mana arcane_charge(4)
3:16.963 aoe q arcane_explosion Fluffy_Pillow 44535.9/63371: 70% mana
3:18.270 aoe q arcane_explosion Fluffy_Pillow 41192.4/63371: 65% mana arcane_charge
3:19.577 aoe q arcane_explosion Fluffy_Pillow 37849.0/63371: 60% mana arcane_charge(2)
3:20.882 aoe q arcane_explosion Fluffy_Pillow 34502.9/63371: 54% mana arcane_charge(3), clearcasting
3:22.188 aoe r arcane_barrage Fluffy_Pillow 36158.2/63371: 57% mana arcane_charge(4)
3:23.497 aoe q arcane_explosion Fluffy_Pillow 40352.1/63371: 64% mana
3:24.801 aoe q arcane_explosion Fluffy_Pillow 37004.9/63371: 58% mana arcane_charge
3:26.107 aoe q arcane_explosion Fluffy_Pillow 33660.1/63371: 53% mana arcane_charge(2)
3:27.412 aoe q arcane_explosion Fluffy_Pillow 30314.1/63371: 48% mana arcane_charge(3), clearcasting
3:28.719 aoe r arcane_barrage Fluffy_Pillow 31970.6/63371: 50% mana arcane_charge(4)
3:30.025 aoe k touch_of_the_magi Fluffy_Pillow 36160.8/63371: 57% mana
3:31.331 aoe m rune_of_power Fluffy_Pillow 35316.0/63371: 56% mana arcane_charge(4)
3:32.639 aoe r arcane_barrage Fluffy_Pillow 36973.8/63371: 58% mana arcane_charge(4), rune_of_power
3:33.946 aoe q arcane_explosion Fluffy_Pillow 41165.2/63371: 65% mana rune_of_power
3:35.254 aoe q arcane_explosion Fluffy_Pillow 37823.0/63371: 60% mana arcane_charge, clearcasting, rune_of_power
3:36.561 aoe q arcane_explosion Fluffy_Pillow 39479.5/63371: 62% mana arcane_charge(2), rune_of_power
3:37.867 aoe q arcane_explosion Fluffy_Pillow 36134.8/63371: 57% mana arcane_charge(3), rune_of_power
3:39.176 aoe r arcane_barrage Fluffy_Pillow 32793.9/63371: 52% mana arcane_charge(4), rune_of_power
3:40.480 aoe p arcane_orb Fluffy_Pillow 36981.4/63371: 58% mana rune_of_power
3:41.787 aoe r arcane_barrage Fluffy_Pillow 38138.0/63371: 60% mana arcane_charge(4), rune_of_power
3:43.094 aoe q arcane_explosion Fluffy_Pillow 42329.4/63371: 67% mana rune_of_power
3:44.400 aoe q arcane_explosion Fluffy_Pillow 38984.6/63371: 62% mana arcane_charge, clearcasting, rune_of_power
3:45.706 aoe q arcane_explosion Fluffy_Pillow 40639.9/63371: 64% mana arcane_charge(2), rune_of_power
3:47.012 aoe q arcane_explosion Fluffy_Pillow 37295.1/63371: 59% mana arcane_charge(3), rune_of_power
3:48.319 aoe r arcane_barrage Fluffy_Pillow 33951.7/63371: 54% mana arcane_charge(4)
3:49.626 aoe q arcane_explosion Fluffy_Pillow 38143.1/63371: 60% mana
3:50.931 aoe q arcane_explosion Fluffy_Pillow 34797.1/63371: 55% mana arcane_charge
3:52.236 aoe q arcane_explosion Fluffy_Pillow 31451.0/63371: 50% mana arcane_charge(2)
3:53.541 aoe q arcane_explosion Fluffy_Pillow 28105.0/63371: 44% mana arcane_charge(3)
3:54.847 aoe r arcane_barrage Fluffy_Pillow 24760.3/63371: 39% mana arcane_charge(4), clearcasting
3:56.153 aoe q arcane_explosion Fluffy_Pillow 28950.4/63371: 46% mana clearcasting
3:57.458 aoe q arcane_explosion Fluffy_Pillow 30604.4/63371: 48% mana arcane_charge
3:58.765 aoe q arcane_explosion Fluffy_Pillow 27260.9/63371: 43% mana arcane_charge(2)
4:00.071 aoe q arcane_explosion Fluffy_Pillow 23916.2/63371: 38% mana arcane_charge(3)
4:01.376 aoe r arcane_barrage Fluffy_Pillow 20570.2/63371: 32% mana arcane_charge(4)
4:02.683 aoe p arcane_orb Fluffy_Pillow 24761.6/63371: 39% mana
4:03.991 aoe r arcane_barrage Fluffy_Pillow 25919.4/63371: 41% mana arcane_charge(4)
4:05.298 shared_cds y use_mana_gem Necrolord_Marileth 30110.8/63371: 48% mana
4:05.298 aoe q arcane_explosion Fluffy_Pillow 36447.9/63371: 58% mana
4:06.603 aoe q arcane_explosion Fluffy_Pillow 33101.9/63371: 52% mana arcane_charge
4:07.909 aoe q arcane_explosion Fluffy_Pillow 29757.2/63371: 47% mana arcane_charge(2)
4:09.217 aoe q arcane_explosion Fluffy_Pillow 26415.0/63371: 42% mana arcane_charge(3)
4:10.521 aoe r arcane_barrage Fluffy_Pillow 23067.7/63371: 36% mana arcane_charge(4)
4:11.826 aoe q arcane_explosion Fluffy_Pillow 27256.5/63371: 43% mana
4:13.131 aoe q arcane_explosion Fluffy_Pillow 23910.5/63371: 38% mana arcane_charge
4:14.437 aoe q arcane_explosion Fluffy_Pillow 20565.8/63371: 32% mana arcane_charge(2)
4:15.743 aoe q arcane_explosion Fluffy_Pillow 17221.1/63371: 27% mana arcane_charge(3)
4:17.050 aoe r arcane_barrage Fluffy_Pillow 13877.6/63371: 22% mana arcane_charge(4)
4:18.358 aoe j deathborne Fluffy_Pillow 18070.2/63371: 29% mana
4:19.664 aoe k touch_of_the_magi Fluffy_Pillow 17225.5/63371: 27% mana deathborne
4:20.969 aoe l arcane_power Fluffy_Pillow 16379.5/63371: 26% mana arcane_charge(4), deathborne
4:20.969 shared_cds { berserking Fluffy_Pillow 16379.5/63371: 26% mana arcane_charge(4), arcane_power, rune_of_power, deathborne
4:20.969 aoe o arcane_blast Fluffy_Pillow 16379.5/63371: 26% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne
4:22.181 aoe o arcane_blast Fluffy_Pillow 14478.1/63371: 23% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne
4:23.392 aoe o arcane_blast Fluffy_Pillow 12575.5/63371: 20% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne
4:24.605 aoe o arcane_blast Fluffy_Pillow 10675.4/63371: 17% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne
4:25.818 aoe n presence_of_mind Fluffy_Pillow 8775.3/63371: 14% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne
4:25.818 aoe o arcane_blast Fluffy_Pillow 8775.3/63371: 14% mana berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne
4:27.006 aoe o arcane_blast Fluffy_Pillow 6843.5/63371: 11% mana berserking, arcane_charge(4), arcane_power, presence_of_mind(2), rune_of_power, deathborne
4:28.193 aoe o arcane_blast Fluffy_Pillow 4910.4/63371: 8% mana berserking, arcane_charge(4), arcane_power, presence_of_mind, rune_of_power, deathborne
4:29.383 aoe r arcane_barrage Fluffy_Pillow 2981.1/63371: 5% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne
4:30.570 aoe o arcane_blast Fluffy_Pillow 7020.4/63371: 11% mana berserking, arcane_power, clearcasting, rune_of_power, deathborne
4:32.350 aoe o arcane_blast Fluffy_Pillow 8589.0/63371: 14% mana berserking, arcane_charge, arcane_power, clearcasting, rune_of_power, deathborne
4:33.987 aoe o arcane_blast Fluffy_Pillow 9288.7/63371: 15% mana arcane_charge(2), arcane_power, clearcasting, rune_of_power, deathborne
4:35.631 aoe o arcane_blast Fluffy_Pillow 9309.9/63371: 15% mana arcane_charge(3), arcane_power, clearcasting, rune_of_power, deathborne
4:37.120 aoe m rune_of_power Fluffy_Pillow 5697.1/63371: 9% mana arcane_charge(4), clearcasting, deathborne
4:38.429 aoe o arcane_blast Fluffy_Pillow 7356.2/63371: 12% mana arcane_charge(4), clearcasting, rune_of_power, deathborne
4:39.761 aoe r arcane_barrage Fluffy_Pillow 2169.4/63371: 3% mana arcane_charge(4), clearcasting, rune_of_power
4:41.067 aoe p arcane_orb Fluffy_Pillow 6359.5/63371: 10% mana clearcasting, rune_of_power
4:42.374 aoe r arcane_barrage Fluffy_Pillow 7516.0/63371: 12% mana arcane_charge(4), clearcasting, rune_of_power
4:43.680 aoe q arcane_explosion Fluffy_Pillow 11706.1/63371: 18% mana rune_of_power
4:44.986 aoe q arcane_explosion Fluffy_Pillow 8361.4/63371: 13% mana arcane_charge, rune_of_power
4:46.290 aoe q arcane_explosion Fluffy_Pillow 5014.1/63371: 8% mana arcane_charge(2), rune_of_power
4:47.597 aoe s evocation Fluffy_Pillow 1670.7/63371: 3% mana arcane_charge(3), rune_of_power
4:51.941 aoe q arcane_explosion Fluffy_Pillow 55515.3/63371: 88% mana arcane_charge(3), rune_of_power
4:53.248 aoe r arcane_barrage Fluffy_Pillow 52171.9/63371: 82% mana arcane_charge(4), clearcasting, rune_of_power
4:54.555 aoe q arcane_explosion Fluffy_Pillow 56363.2/63371: 89% mana clearcasting
4:55.863 aoe q arcane_explosion Fluffy_Pillow 58021.0/63371: 92% mana arcane_charge
4:57.168 aoe q arcane_explosion Fluffy_Pillow 54675.0/63371: 86% mana arcane_charge(2)
4:58.475 aoe q arcane_explosion Fluffy_Pillow 51331.6/63371: 81% mana arcane_charge(3)
4:59.781 aoe r arcane_barrage Fluffy_Pillow 47986.8/63371: 76% mana arcane_charge(4)
5:01.089 aoe p arcane_orb Fluffy_Pillow 52179.5/63371: 82% mana
5:02.397 aoe r arcane_barrage Fluffy_Pillow 53337.3/63371: 84% mana arcane_charge(4)
5:03.704 aoe q arcane_explosion Fluffy_Pillow 57528.7/63371: 91% mana
5:05.010 aoe q arcane_explosion Fluffy_Pillow 54183.9/63371: 86% mana arcane_charge, clearcasting
5:06.317 aoe q arcane_explosion Fluffy_Pillow 55840.5/63371: 88% mana arcane_charge(2)
5:07.622 aoe q arcane_explosion Fluffy_Pillow 52494.4/63371: 83% mana arcane_charge(3)
5:08.928 aoe r arcane_barrage Fluffy_Pillow 49149.7/63371: 78% mana arcane_charge(4), clearcasting
5:10.234 aoe q arcane_explosion Fluffy_Pillow 53339.8/63371: 84% mana clearcasting
5:11.541 aoe q arcane_explosion Fluffy_Pillow 54996.4/63371: 87% mana arcane_charge
5:12.850 aoe q arcane_explosion Fluffy_Pillow 51655.4/63371: 82% mana arcane_charge(2)
5:14.158 aoe q arcane_explosion Fluffy_Pillow 48313.2/63371: 76% mana arcane_charge(3), clearcasting
5:15.467 aoe r arcane_barrage Fluffy_Pillow 49972.3/63371: 79% mana arcane_charge(4)
5:16.773 aoe q arcane_explosion Fluffy_Pillow 54162.4/63371: 85% mana
5:18.080 aoe q arcane_explosion Fluffy_Pillow 50818.9/63371: 80% mana arcane_charge
5:19.387 aoe q arcane_explosion Fluffy_Pillow 47475.5/63371: 75% mana arcane_charge(2)
5:20.694 aoe q arcane_explosion Fluffy_Pillow 44132.0/63371: 70% mana arcane_charge(3)
5:22.000 aoe r arcane_barrage Fluffy_Pillow 40787.2/63371: 64% mana arcane_charge(4)
5:23.303 aoe k touch_of_the_magi Fluffy_Pillow 44973.6/63371: 71% mana
5:24.610 aoe m rune_of_power Fluffy_Pillow 44130.1/63371: 70% mana arcane_charge(4)
5:25.916 aoe r arcane_barrage Fluffy_Pillow 45785.4/63371: 72% mana arcane_charge(4), rune_of_power
5:27.223 aoe p arcane_orb Fluffy_Pillow 49976.7/63371: 79% mana rune_of_power
5:28.529 aoe r arcane_barrage Fluffy_Pillow 51132.0/63371: 81% mana arcane_charge(4), rune_of_power
5:29.837 aoe q arcane_explosion Fluffy_Pillow 55324.7/63371: 87% mana rune_of_power
5:31.144 aoe q arcane_explosion Fluffy_Pillow 51981.2/63371: 82% mana arcane_charge, rune_of_power
5:32.449 aoe q arcane_explosion Fluffy_Pillow 48635.2/63371: 77% mana arcane_charge(2), rune_of_power
5:33.756 aoe q arcane_explosion Fluffy_Pillow 45291.7/63371: 71% mana arcane_charge(3), clearcasting, rune_of_power
5:35.064 aoe r arcane_barrage Fluffy_Pillow 46949.5/63371: 74% mana arcane_charge(4), rune_of_power
5:36.371 aoe q arcane_explosion Fluffy_Pillow 51140.9/63371: 81% mana rune_of_power
5:37.678 aoe q arcane_explosion Fluffy_Pillow 47797.4/63371: 75% mana arcane_charge, rune_of_power
5:38.984 aoe q arcane_explosion Fluffy_Pillow 44452.7/63371: 70% mana arcane_charge(2), rune_of_power
5:40.289 aoe q arcane_explosion Fluffy_Pillow 41106.7/63371: 65% mana arcane_charge(3), clearcasting, rune_of_power
5:41.595 aoe r arcane_barrage Fluffy_Pillow 42761.9/63371: 67% mana arcane_charge(4)
5:42.901 aoe q arcane_explosion Fluffy_Pillow 46952.1/63371: 74% mana
5:44.209 aoe q arcane_explosion Fluffy_Pillow 43609.9/63371: 69% mana arcane_charge
5:45.517 aoe q arcane_explosion Fluffy_Pillow 40267.7/63371: 64% mana arcane_charge(2), clearcasting
5:46.823 aoe q arcane_explosion Fluffy_Pillow 41922.9/63371: 66% mana arcane_charge(3)
5:48.130 aoe r arcane_barrage Fluffy_Pillow 38579.4/63371: 61% mana arcane_charge(4), clearcasting
5:49.436 aoe p arcane_orb Fluffy_Pillow 42769.6/63371: 67% mana clearcasting
5:50.744 aoe r arcane_barrage Fluffy_Pillow 43927.4/63371: 69% mana arcane_charge(4), clearcasting(2)
5:52.049 aoe q arcane_explosion Fluffy_Pillow 48116.2/63371: 76% mana clearcasting(2)
5:53.356 aoe q arcane_explosion Fluffy_Pillow 49772.7/63371: 79% mana arcane_charge, clearcasting
5:54.663 aoe q arcane_explosion Fluffy_Pillow 51429.3/63371: 81% mana arcane_charge(2)
5:55.969 aoe q arcane_explosion Fluffy_Pillow 48084.5/63371: 76% mana arcane_charge(3), clearcasting

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Necrolord_Marileth"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=necrolord
soulbind=arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

NightFae_Dream : 10297 dps, 4147 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
10297.1 10297.1 10.5 / 0.102% 827.2 / 8.0% 5.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
1886.5 1785.6 Mana 0.00% 47.9 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Dream 10297
Arcane Barrage 2821 27.4% 54.4 5.55sec 15599 12599 Direct 163.0 4366 8738 5206 19.2%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.42 163.04 0.00 0.00 1.2381 0.0000 848891.32 848891.32 0.00% 12598.94 12598.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 131.69 95 168 4365.59 2082 10930 4365.63 3902 4779 574884 574884 0.00%
crit 19.23% 31.35 13 52 8738.13 4164 21861 8738.03 6121 12785 274008 274008 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:54.42
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 289 2.8% 41.5 6.89sec 2097 0 Direct 124.5 586 1173 699 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.49 124.46 0.00 0.00 0.0000 0.0000 87007.78 87007.78 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.71% 100.45 70 135 585.93 443 664 585.88 562 613 58854 58854 0.00%
crit 19.29% 24.01 9 41 1172.59 886 1329 1172.80 1022 1329 28154 28154 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 5059 49.1% 143.1 2.07sec 10640 8555 Direct 429.4 2973 5953 3547 19.2%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 143.13 429.38 0.00 0.00 1.2438 0.0000 1522924.19 1522924.19 0.00% 8554.65 8554.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.75% 346.72 269 429 2973.16 2128 4469 2973.02 2870 3064 1030930 1030930 0.00%
crit 19.25% 82.65 48 117 5952.71 4256 8938 5950.91 5373 6584 491994 491994 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.546000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 54.6%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:143.11
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (885) 0.0% (8.6%) 13.9 22.33sec 19101 15466

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.91 0.00 0.00 0.00 1.2351 0.0000 0.00 0.00 0.00% 15466.24 15466.24

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.91
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 885 8.6% 41.7 22.34sec 6380 0 Direct 41.7 5336 10695 6379 19.5%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.66 41.66 0.00 0.00 0.0000 0.0000 265787.33 265787.33 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.53% 33.55 20 46 5336.42 3869 8126 5346.78 4759 6046 179039 179039 0.00%
crit 19.47% 8.11 1 18 10694.52 7739 16251 10714.14 7739 16251 86748 86748 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (85) 0.0% (0.8%) 18.8 9.38sec 1390 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.77 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 85 0.8% 18.8 9.38sec 1390 0 Direct 18.8 1164 2327 1390 19.5%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.77 18.77 0.00 0.00 0.0000 0.0000 26084.34 26084.34 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.54% 15.12 5 28 1163.53 1164 1164 1163.53 1164 1164 17587 17587 0.00%
crit 19.46% 3.65 0 13 2327.06 2327 2327 2230.80 0 2327 8497 8497 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1781 20.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1779.15 1779.15 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.84% 0.80 0 1 1480.68 1481 1481 1182.21 0 1481 1182 1182 0.00%
crit 20.16% 0.20 0 1 2961.35 2961 2961 596.94 0 2961 597 597 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 6030 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 151  / 20 0.2% 90.0 1.29sec 67 51 Direct 90.0 56 112 67 19.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6030.29 6030.29 0.00% 51.20 51.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.83% 72.75 58 86 56.22 43 60 56.22 55 57 4090 4090 0.00%
crit 19.17% 17.25 4 32 112.46 86 120 112.45 101 120 1940 1940 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Shifting Power 386 3.7% 6.0 49.55sec 19519 5467 Periodic 71.0 1372 2745 1636 19.2% 2.2%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.95 0.00 23.68 71.03 3.5702 0.8342 116204.52 116204.52 0.00% 5467.42 5467.42
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.79% 57.38 39 76 1372.31 1372 1372 1372.31 1372 1372 78748 78748 0.00%
crit 19.21% 13.65 3 28 2744.61 2745 2745 2744.61 2745 2745 37457 37457 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:5.95
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (746) 0.0% (7.2%) 6.6 49.15sec 34084 26089

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.59 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 26088.74 26088.74

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.62
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 746 7.2% 6.6 48.98sec 34084 0 Direct 19.7 11416 0 11416 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.59 19.65 0.00 0.00 0.0000 0.0000 224441.41 224441.41 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 19.65 15 24 11416.24 1517 40493 11442.52 9056 14847 224441 224441 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:20102.40
  • base_dd_max:20102.40
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Dream
Arcane Power 3.6 97.22sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.58 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.58
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.74sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.3 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.26 0.00 1.54 0.00 4.2633 0.7210 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.26
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.49sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.49
  • if_expr:buff.arcane_power.up
Rune of Power 6.4 48.04sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.39 0.00 0.00 0.00 1.2595 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.42
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 120.61sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.81 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.82
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 55.2 150.1 5.5sec 1.5sec 4.2sec 76.32% 0.00% 3.5 (5.4) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 16.0s
  • trigger_min/max:0.0s / 9.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.5s

Stack Uptimes

  • arcane_charge_1:21.30%
  • arcane_charge_2:18.92%
  • arcane_charge_3:14.52%
  • arcane_charge_4:21.58%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 97.2sec 97.2sec 14.7sec 17.48% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 102.1s
  • trigger_min/max:96.0s / 102.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:17.48%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 194.7sec 194.7sec 12.0sec 8.07% 23.61% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:193.4s / 199.3s
  • trigger_min/max:193.4s / 199.3s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.07%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.46% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.46%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.5 0.2 12.9sec 12.8sec 2.2sec 16.38% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.15%
  • clearcasting_2:0.23%
  • clearcasting_3:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.3 0.0 0.0sec 0.0sec 4.3sec 0.36% 0.00% 1.0 (1.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 4.3s

Stack Uptimes

  • evocation_1:0.37%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.5 0.0 300.5sec 300.5sec 23.3sec 11.35% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 301.0s
  • trigger_min/max:300.0s / 301.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.35%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 10.0 0.0 31.5sec 31.5sec 14.6sec 48.44% 0.00% 0.0 (0.0) 9.5

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:16.8s / 48.7s
  • trigger_min/max:16.8s / 48.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:48.44%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.60% 0.76% 6.01% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 301.2s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000205.223144.154263.984
Evocation224.051124.638353.794286.434167.244359.984
Rune of Power14.2600.00436.57594.26876.578112.277
Touch of the Magi10.8840.00018.74374.16656.88092.982
Arcane Power1.2470.0046.1104.4652.6868.902
Arcane Barrage3.0410.00012.245166.856132.439201.992
Arcane Orb4.5970.00012.51764.58547.10181.859
Shifting Power9.3330.00033.25255.66150.23263.446

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Dream
mana_regen Mana 687.40 374046.52 69.53% 544.15 7178.27 1.88%
Evocation Mana 12.33 12402.60 2.31% 1005.62 0.00 0.00%
Mana Gem Mana 2.82 17842.00 3.32% 6337.14 0.00 0.00%
Arcane Barrage Mana 54.42 133640.74 24.84% 2455.59 4313.79 3.13%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1785.63 1886.51 11515.3 32983.3 1960.6 63371.4
Usage Type Count Total Avg RPE APR
NightFae_Dream
arcane_explosion Mana 143.1 529657.2 3701.1 3700.7 2.9
arcane_orb Mana 13.9 6199.3 445.5 445.5 42.9
shifting_power Mana 6.0 14884.7 2500.0 2500.2 7.8
touch_of_the_magi Mana 6.6 16473.4 2500.0 2501.6 13.6

Statistics & Data Analysis

Fight Length
NightFae_Dream Fight Length
Count 1523
Mean 301.22
Minimum 240.15
Maximum 359.98
Spread ( max - min ) 119.83
Range [ ( max - min ) / 2 * 100% ] 19.89%
DPS
NightFae_Dream Damage Per Second
Count 1523
Mean 10297.07
Minimum 9685.34
Maximum 11048.05
Spread ( max - min ) 1362.71
Range [ ( max - min ) / 2 * 100% ] 6.62%
Standard Deviation 208.8152
5th Percentile 9956.22
95th Percentile 10647.46
( 95th Percentile - 5th Percentile ) 691.24
Mean Distribution
Standard Deviation 5.3507
95.00% Confidence Interval ( 10286.58 - 10307.56 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1580
0.1 Scale Factor Error with Delta=300 373
0.05 Scale Factor Error with Delta=300 1489
0.01 Scale Factor Error with Delta=300 37223
Priority Target DPS
NightFae_Dream Priority Target Damage Per Second
Count 1523
Mean 4147.38
Minimum 3807.45
Maximum 4642.40
Spread ( max - min ) 834.95
Range [ ( max - min ) / 2 * 100% ] 10.07%
Standard Deviation 121.0589
5th Percentile 3952.91
95th Percentile 4350.01
( 95th Percentile - 5th Percentile ) 397.10
Mean Distribution
Standard Deviation 3.1020
95.00% Confidence Interval ( 4141.30 - 4153.46 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 33
0.1% Error 3273
0.1 Scale Factor Error with Delta=300 126
0.05 Scale Factor Error with Delta=300 501
0.01 Scale Factor Error with Delta=300 12511
DPS(e)
NightFae_Dream Damage Per Second (Effective)
Count 1523
Mean 10297.07
Minimum 9685.34
Maximum 11048.05
Spread ( max - min ) 1362.71
Range [ ( max - min ) / 2 * 100% ] 6.62%
Damage
NightFae_Dream Damage
Count 1523
Mean 3093120.04
Minimum 2424313.33
Maximum 3742995.82
Spread ( max - min ) 1318682.49
Range [ ( max - min ) / 2 * 100% ] 21.32%
DTPS
NightFae_Dream Damage Taken Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Dream Healing Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Dream Healing Per Second (Effective)
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Dream Heal
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Dream Healing Taken Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Dream Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_DreamTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Dream Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.62 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.58 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.42 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.91 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 5.95 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 143.11 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 54.42 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.26 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.82 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.49 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjkstpmpoooopoooopoooolpoooropmpoooopoonoopmpoooopoojlpoooopmpoooopoooopoonoopmpoooopojkpoooopoooopmlpoooopooooponooopmproooopjlpoooopoooopmpooooponooopmpoooopjktpoooopoooopmpoooolpoooopoooopmnpoooopmpoojlpooooporooopmpoooopoonoopmpojkpooooposooopoooolpmpoooopoooonpmpoooopoojlpoooopm

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask NightFae_Dream 63371.4/63371: 100% mana
Pre precombat R food NightFae_Dream 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana
0:01.305 aoe k arcane_power Fluffy_Pillow 60875.2/63371: 96% mana bloodlust, arcane_charge(4), clearcasting
0:01.305 shared_cds s potion Fluffy_Pillow 60875.2/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power
0:01.305 shared_cds t berserking Fluffy_Pillow 60875.2/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:01.305 aoe p arcane_barrage Fluffy_Pillow 60875.2/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:02.217 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:03.132 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:04.047 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:04.961 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.875 aoe o arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:06.788 aoe o arcane_explosion Fluffy_Pillow 63187.0/63371: 100% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.703 aoe p arcane_barrage Fluffy_Pillow 61846.7/63371: 98% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.620 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.535 aoe o arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.449 aoe o arcane_explosion Fluffy_Pillow 60689.6/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.363 aoe o arcane_explosion Fluffy_Pillow 59348.0/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.278 aoe p arcane_barrage Fluffy_Pillow 58007.7/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.191 aoe o arcane_explosion Fluffy_Pillow 61699.7/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.105 aoe o arcane_explosion Fluffy_Pillow 60358.1/63371: 95% mana bloodlust, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:15.112 aoe o arcane_explosion Fluffy_Pillow 59134.4/63371: 93% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:16.119 aoe o arcane_explosion Fluffy_Pillow 57910.7/63371: 91% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:17.126 aoe l rune_of_power Fluffy_Pillow 56687.0/63371: 89% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:18.132 aoe p arcane_barrage Fluffy_Pillow 57962.1/63371: 91% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:19.138 aoe o arcane_explosion Fluffy_Pillow 61772.0/63371: 97% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:20.145 aoe o arcane_explosion Fluffy_Pillow 58048.3/63371: 92% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:21.151 aoe o arcane_explosion Fluffy_Pillow 54323.3/63371: 86% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:22.158 shared_cds r use_mana_gem NightFae_Dream 50599.6/63371: 80% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:22.158 aoe o arcane_explosion Fluffy_Pillow 56936.7/63371: 90% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.166 aoe p arcane_barrage Fluffy_Pillow 53214.3/63371: 84% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:24.171 aoe m arcane_orb Fluffy_Pillow 57022.9/63371: 90% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:25.178 aoe p arcane_barrage Fluffy_Pillow 57799.2/63371: 91% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:26.186 aoe o arcane_explosion Fluffy_Pillow 61611.7/63371: 97% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:27.192 aoe o arcane_explosion Fluffy_Pillow 57886.7/63371: 91% mana bloodlust, arcane_charge, rune_of_power
0:28.199 aoe o arcane_explosion Fluffy_Pillow 54163.0/63371: 85% mana bloodlust, arcane_charge(2), rune_of_power
0:29.207 aoe o arcane_explosion Fluffy_Pillow 50440.6/63371: 80% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power
0:30.212 aoe p arcane_barrage Fluffy_Pillow 51714.3/63371: 82% mana bloodlust, arcane_charge(4), rune_of_power
0:31.217 aoe o arcane_explosion Fluffy_Pillow 55522.9/63371: 88% mana bloodlust, rune_of_power
0:32.223 aoe o arcane_explosion Fluffy_Pillow 51798.0/63371: 82% mana bloodlust, arcane_charge, rune_of_power
0:33.230 aoe n shifting_power Fluffy_Pillow 48074.3/63371: 76% mana bloodlust, arcane_charge(2)
0:36.122 aoe o arcane_explosion Fluffy_Pillow 49239.7/63371: 78% mana bloodlust, arcane_charge(2)
0:37.129 aoe o arcane_explosion Fluffy_Pillow 45516.0/63371: 72% mana bloodlust, arcane_charge(3)
0:38.137 aoe p arcane_barrage Fluffy_Pillow 41793.5/63371: 66% mana bloodlust, arcane_charge(4)
0:39.143 aoe m arcane_orb Fluffy_Pillow 45603.4/63371: 72% mana bloodlust
0:40.151 aoe p arcane_barrage Fluffy_Pillow 46381.0/63371: 73% mana bloodlust, arcane_charge(4)
0:41.159 aoe o arcane_explosion Fluffy_Pillow 50193.4/63371: 79% mana
0:42.465 aoe o arcane_explosion Fluffy_Pillow 46848.7/63371: 74% mana arcane_charge, clearcasting
0:43.772 aoe o arcane_explosion Fluffy_Pillow 48505.2/63371: 77% mana arcane_charge(2)
0:45.079 aoe o arcane_explosion Fluffy_Pillow 45161.7/63371: 71% mana arcane_charge(3), clearcasting
0:46.386 aoe p arcane_barrage Fluffy_Pillow 46818.3/63371: 74% mana arcane_charge(4)
0:47.693 aoe o arcane_explosion Fluffy_Pillow 51009.7/63371: 80% mana
0:49.000 aoe o arcane_explosion Fluffy_Pillow 47666.2/63371: 75% mana arcane_charge
0:50.306 aoe j touch_of_the_magi Fluffy_Pillow 44321.5/63371: 70% mana arcane_charge(2)
0:51.613 aoe l rune_of_power Fluffy_Pillow 43478.0/63371: 69% mana arcane_charge(4), clearcasting
0:52.921 aoe p arcane_barrage Fluffy_Pillow 45135.8/63371: 71% mana arcane_charge(4), clearcasting, rune_of_power
0:54.228 aoe o arcane_explosion Fluffy_Pillow 49327.2/63371: 78% mana clearcasting, rune_of_power
0:55.535 aoe o arcane_explosion Fluffy_Pillow 50983.7/63371: 80% mana arcane_charge, rune_of_power
0:56.841 aoe o arcane_explosion Fluffy_Pillow 47639.0/63371: 75% mana arcane_charge(2), rune_of_power
0:58.149 aoe o arcane_explosion Fluffy_Pillow 44296.8/63371: 70% mana arcane_charge(3), clearcasting, rune_of_power
0:59.456 aoe p arcane_barrage Fluffy_Pillow 45953.3/63371: 73% mana arcane_charge(4), rune_of_power
1:00.760 aoe m arcane_orb Fluffy_Pillow 50140.9/63371: 79% mana rune_of_power
1:02.067 aoe p arcane_barrage Fluffy_Pillow 51297.4/63371: 81% mana arcane_charge(4), rune_of_power
1:03.373 aoe o arcane_explosion Fluffy_Pillow 55487.5/63371: 88% mana rune_of_power
1:04.677 aoe o arcane_explosion Fluffy_Pillow 52140.2/63371: 82% mana arcane_charge, rune_of_power
1:05.985 aoe o arcane_explosion Fluffy_Pillow 48798.0/63371: 77% mana arcane_charge(2), rune_of_power
1:07.292 aoe o arcane_explosion Fluffy_Pillow 45454.6/63371: 72% mana arcane_charge(3), rune_of_power
1:08.600 aoe p arcane_barrage Fluffy_Pillow 42112.4/63371: 66% mana arcane_charge(4)
1:09.906 aoe o arcane_explosion Fluffy_Pillow 46302.5/63371: 73% mana
1:11.212 aoe o arcane_explosion Fluffy_Pillow 42957.7/63371: 68% mana arcane_charge
1:12.519 aoe o arcane_explosion Fluffy_Pillow 39614.3/63371: 63% mana arcane_charge(2)
1:13.826 aoe o arcane_explosion Fluffy_Pillow 36270.8/63371: 57% mana arcane_charge(3)
1:15.133 aoe p arcane_barrage Fluffy_Pillow 32927.3/63371: 52% mana arcane_charge(4)
1:16.440 aoe o arcane_explosion Fluffy_Pillow 37118.7/63371: 59% mana
1:17.747 aoe o arcane_explosion Fluffy_Pillow 33775.2/63371: 53% mana arcane_charge
1:19.055 aoe n shifting_power Fluffy_Pillow 30433.0/63371: 48% mana arcane_charge(2)
1:22.789 aoe o arcane_explosion Fluffy_Pillow 32665.6/63371: 52% mana arcane_charge(2)
1:24.095 aoe o arcane_explosion Fluffy_Pillow 29320.9/63371: 46% mana arcane_charge(3), clearcasting
1:25.401 aoe p arcane_barrage Fluffy_Pillow 30976.1/63371: 49% mana arcane_charge(4)
1:26.706 aoe m arcane_orb Fluffy_Pillow 35165.0/63371: 55% mana
1:28.014 aoe p arcane_barrage Fluffy_Pillow 36322.8/63371: 57% mana arcane_charge(4)
1:29.320 aoe o arcane_explosion Fluffy_Pillow 40512.9/63371: 64% mana
1:30.624 aoe o arcane_explosion Fluffy_Pillow 37165.6/63371: 59% mana arcane_charge
1:31.930 aoe o arcane_explosion Fluffy_Pillow 33820.9/63371: 53% mana arcane_charge(2)
1:33.238 aoe o arcane_explosion Fluffy_Pillow 30478.7/63371: 48% mana arcane_charge(3), clearcasting
1:34.546 aoe p arcane_barrage Fluffy_Pillow 32136.5/63371: 51% mana arcane_charge(4)
1:35.853 aoe o arcane_explosion Fluffy_Pillow 36327.9/63371: 57% mana
1:37.160 aoe j touch_of_the_magi Fluffy_Pillow 32984.4/63371: 52% mana arcane_charge
1:38.469 aoe k arcane_power Fluffy_Pillow 32143.5/63371: 51% mana arcane_charge(4)
1:38.469 aoe p arcane_barrage Fluffy_Pillow 32143.5/63371: 51% mana arcane_charge(4), arcane_power, rune_of_power
1:39.776 aoe o arcane_explosion Fluffy_Pillow 36334.9/63371: 57% mana arcane_power, rune_of_power
1:41.084 aoe o arcane_explosion Fluffy_Pillow 35492.7/63371: 56% mana arcane_charge, arcane_power, rune_of_power
1:42.391 aoe o arcane_explosion Fluffy_Pillow 34649.2/63371: 55% mana arcane_charge(2), arcane_power, rune_of_power
1:43.698 aoe o arcane_explosion Fluffy_Pillow 33805.7/63371: 53% mana arcane_charge(3), arcane_power, rune_of_power
1:45.004 aoe p arcane_barrage Fluffy_Pillow 32961.0/63371: 52% mana arcane_charge(4), arcane_power, rune_of_power
1:46.310 aoe o arcane_explosion Fluffy_Pillow 37151.1/63371: 59% mana arcane_power, rune_of_power
1:47.616 aoe o arcane_explosion Fluffy_Pillow 36306.4/63371: 57% mana arcane_charge, arcane_power, rune_of_power
1:48.924 aoe o arcane_explosion Fluffy_Pillow 35464.2/63371: 56% mana arcane_charge(2), arcane_power, rune_of_power
1:50.230 aoe o arcane_explosion Fluffy_Pillow 34619.4/63371: 55% mana arcane_charge(3), arcane_power, rune_of_power
1:51.538 aoe p arcane_barrage Fluffy_Pillow 33777.2/63371: 53% mana arcane_charge(4), arcane_power, rune_of_power
1:52.844 aoe m arcane_orb Fluffy_Pillow 37967.3/63371: 60% mana arcane_power, rune_of_power
1:54.150 aoe l rune_of_power Fluffy_Pillow 39372.6/63371: 62% mana arcane_charge(4)
1:55.456 aoe p arcane_barrage Fluffy_Pillow 41027.9/63371: 65% mana arcane_charge(4), rune_of_power
1:56.763 aoe o arcane_explosion Fluffy_Pillow 45219.2/63371: 71% mana rune_of_power
1:58.071 aoe o arcane_explosion Fluffy_Pillow 41877.0/63371: 66% mana arcane_charge, rune_of_power
1:59.378 aoe o arcane_explosion Fluffy_Pillow 38533.6/63371: 61% mana arcane_charge(2), rune_of_power
2:00.684 aoe o arcane_explosion Fluffy_Pillow 35188.8/63371: 56% mana arcane_charge(3), rune_of_power
2:01.989 aoe p arcane_barrage Fluffy_Pillow 31842.8/63371: 50% mana arcane_charge(4), rune_of_power
2:03.294 aoe o arcane_explosion Fluffy_Pillow 36031.7/63371: 57% mana rune_of_power
2:04.601 aoe o arcane_explosion Fluffy_Pillow 32688.2/63371: 52% mana arcane_charge, rune_of_power
2:05.906 aoe o arcane_explosion Fluffy_Pillow 29342.2/63371: 46% mana arcane_charge(2), rune_of_power
2:07.211 aoe o arcane_explosion Fluffy_Pillow 25996.2/63371: 41% mana arcane_charge(3), clearcasting, rune_of_power
2:08.518 aoe p arcane_barrage Fluffy_Pillow 27652.7/63371: 44% mana arcane_charge(4), rune_of_power
2:09.824 aoe o arcane_explosion Fluffy_Pillow 31842.8/63371: 50% mana rune_of_power
2:11.132 aoe n shifting_power Fluffy_Pillow 28500.6/63371: 45% mana arcane_charge
2:14.812 aoe o arcane_explosion Fluffy_Pillow 30664.8/63371: 48% mana arcane_charge
2:16.117 aoe o arcane_explosion Fluffy_Pillow 27318.8/63371: 43% mana arcane_charge(2)
2:17.424 aoe o arcane_explosion Fluffy_Pillow 23975.3/63371: 38% mana arcane_charge(3)
2:18.732 aoe p arcane_barrage Fluffy_Pillow 20633.1/63371: 33% mana arcane_charge(4)
2:20.038 aoe m arcane_orb Fluffy_Pillow 24823.2/63371: 39% mana
2:21.345 aoe p arcane_barrage Fluffy_Pillow 25979.7/63371: 41% mana arcane_charge(4)
2:22.653 shared_cds r use_mana_gem NightFae_Dream 30172.4/63371: 48% mana
2:22.653 aoe o arcane_explosion Fluffy_Pillow 36509.5/63371: 58% mana
2:23.960 aoe o arcane_explosion Fluffy_Pillow 33166.1/63371: 52% mana arcane_charge
2:25.267 aoe o arcane_explosion Fluffy_Pillow 29822.6/63371: 47% mana arcane_charge(2), clearcasting
2:26.575 aoe o arcane_explosion Fluffy_Pillow 31480.4/63371: 50% mana arcane_charge(3)
2:27.881 aoe p arcane_barrage Fluffy_Pillow 28135.7/63371: 44% mana arcane_charge(4)
2:29.189 aoe j touch_of_the_magi Fluffy_Pillow 32328.3/63371: 51% mana
2:30.496 aoe l rune_of_power Fluffy_Pillow 31484.8/63371: 50% mana arcane_charge(4)
2:31.802 aoe p arcane_barrage Fluffy_Pillow 33140.1/63371: 52% mana arcane_charge(4), rune_of_power
2:33.107 aoe o arcane_explosion Fluffy_Pillow 37329.0/63371: 59% mana rune_of_power
2:34.413 aoe o arcane_explosion Fluffy_Pillow 33984.2/63371: 54% mana arcane_charge, rune_of_power
2:35.719 aoe o arcane_explosion Fluffy_Pillow 30639.5/63371: 48% mana arcane_charge(2), rune_of_power
2:37.024 aoe o arcane_explosion Fluffy_Pillow 27293.5/63371: 43% mana arcane_charge(3), rune_of_power
2:38.332 aoe p arcane_barrage Fluffy_Pillow 23951.3/63371: 38% mana arcane_charge(4), rune_of_power
2:39.639 aoe o arcane_explosion Fluffy_Pillow 28142.7/63371: 44% mana rune_of_power
2:40.946 aoe o arcane_explosion Fluffy_Pillow 24799.2/63371: 39% mana arcane_charge, rune_of_power
2:42.253 aoe o arcane_explosion Fluffy_Pillow 21455.7/63371: 34% mana arcane_charge(2), rune_of_power
2:43.560 aoe o arcane_explosion Fluffy_Pillow 18112.2/63371: 29% mana arcane_charge(3), clearcasting, rune_of_power
2:44.866 aoe p arcane_barrage Fluffy_Pillow 19767.5/63371: 31% mana arcane_charge(4), rune_of_power
2:46.173 aoe m arcane_orb Fluffy_Pillow 23958.9/63371: 38% mana rune_of_power
2:47.479 aoe p arcane_barrage Fluffy_Pillow 25114.1/63371: 40% mana arcane_charge(4)
2:48.784 aoe o arcane_explosion Fluffy_Pillow 29303.0/63371: 46% mana
2:50.093 aoe o arcane_explosion Fluffy_Pillow 25962.1/63371: 41% mana arcane_charge, clearcasting
2:51.399 aoe o arcane_explosion Fluffy_Pillow 27617.3/63371: 44% mana arcane_charge(2)
2:52.707 aoe o arcane_explosion Fluffy_Pillow 24275.1/63371: 38% mana arcane_charge(3)
2:54.015 aoe p arcane_barrage Fluffy_Pillow 20932.9/63371: 33% mana arcane_charge(4)
2:55.322 aoe o arcane_explosion Fluffy_Pillow 25124.3/63371: 40% mana
2:56.629 aoe n shifting_power Fluffy_Pillow 21780.8/63371: 34% mana arcane_charge
3:00.421 aoe o arcane_explosion Fluffy_Pillow 24086.9/63371: 38% mana arcane_charge
3:01.726 aoe o arcane_explosion Fluffy_Pillow 20740.9/63371: 33% mana arcane_charge(2)
3:03.033 aoe o arcane_explosion Fluffy_Pillow 17397.4/63371: 27% mana arcane_charge(3)
3:04.340 aoe p arcane_barrage Fluffy_Pillow 14054.0/63371: 22% mana arcane_charge(4), clearcasting
3:05.647 aoe m arcane_orb Fluffy_Pillow 18245.4/63371: 29% mana clearcasting
3:06.953 aoe p arcane_barrage Fluffy_Pillow 19400.6/63371: 31% mana arcane_charge(4), clearcasting
3:08.261 aoe o arcane_explosion Fluffy_Pillow 23593.3/63371: 37% mana clearcasting
3:09.569 aoe o arcane_explosion Fluffy_Pillow 25251.1/63371: 40% mana arcane_charge
3:10.876 aoe o arcane_explosion Fluffy_Pillow 21907.6/63371: 35% mana arcane_charge(2)
3:12.182 aoe o arcane_explosion Fluffy_Pillow 18562.9/63371: 29% mana arcane_charge(3)
3:13.489 aoe p arcane_barrage Fluffy_Pillow 15219.4/63371: 24% mana arcane_charge(4)
3:14.796 aoe j touch_of_the_magi Fluffy_Pillow 19410.8/63371: 31% mana
3:16.103 aoe k arcane_power Fluffy_Pillow 18567.3/63371: 29% mana arcane_charge(4)
3:16.103 shared_cds t berserking Fluffy_Pillow 18567.3/63371: 29% mana arcane_charge(4), arcane_power, rune_of_power
3:16.103 aoe p arcane_barrage Fluffy_Pillow 18567.3/63371: 29% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:17.292 aoe o arcane_explosion Fluffy_Pillow 22609.1/63371: 36% mana berserking, arcane_power, rune_of_power
3:18.482 aoe o arcane_explosion Fluffy_Pillow 21617.4/63371: 34% mana berserking, arcane_charge, arcane_power, rune_of_power
3:19.670 aoe o arcane_explosion Fluffy_Pillow 20623.1/63371: 33% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:20.859 aoe o arcane_explosion Fluffy_Pillow 19630.1/63371: 31% mana berserking, arcane_charge(3), arcane_power, rune_of_power
3:22.046 aoe p arcane_barrage Fluffy_Pillow 18634.5/63371: 29% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:23.234 aoe o arcane_explosion Fluffy_Pillow 22675.1/63371: 36% mana berserking, arcane_power, rune_of_power
3:24.423 aoe o arcane_explosion Fluffy_Pillow 21682.0/63371: 34% mana berserking, arcane_charge, arcane_power, rune_of_power
3:25.613 aoe o arcane_explosion Fluffy_Pillow 20690.3/63371: 33% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:26.801 aoe o arcane_explosion Fluffy_Pillow 19696.0/63371: 31% mana berserking, arcane_charge(3), arcane_power, rune_of_power
3:27.990 aoe p arcane_barrage Fluffy_Pillow 18702.9/63371: 30% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:29.177 aoe m arcane_orb Fluffy_Pillow 22742.2/63371: 36% mana arcane_power, rune_of_power
3:30.484 aoe p arcane_barrage Fluffy_Pillow 24148.8/63371: 38% mana arcane_charge(4), arcane_power, rune_of_power
3:31.890 aoe o arcane_explosion Fluffy_Pillow 28465.6/63371: 45% mana
3:33.196 aoe o arcane_explosion Fluffy_Pillow 25120.9/63371: 40% mana arcane_charge
3:34.503 aoe o arcane_explosion Fluffy_Pillow 21777.4/63371: 34% mana arcane_charge(2)
3:35.811 aoe o arcane_explosion Fluffy_Pillow 18435.2/63371: 29% mana arcane_charge(3)
3:37.118 aoe l rune_of_power Fluffy_Pillow 15091.8/63371: 24% mana arcane_charge(4)
3:38.425 aoe p arcane_barrage Fluffy_Pillow 16748.3/63371: 26% mana arcane_charge(4), rune_of_power
3:39.731 aoe o arcane_explosion Fluffy_Pillow 20938.4/63371: 33% mana rune_of_power
3:41.037 aoe o arcane_explosion Fluffy_Pillow 17593.7/63371: 28% mana arcane_charge, rune_of_power
3:42.343 aoe o arcane_explosion Fluffy_Pillow 14248.9/63371: 22% mana arcane_charge(2), rune_of_power
3:43.650 aoe o arcane_explosion Fluffy_Pillow 10905.5/63371: 17% mana arcane_charge(3), rune_of_power
3:44.957 aoe p arcane_barrage Fluffy_Pillow 7562.0/63371: 12% mana arcane_charge(4), rune_of_power
3:46.263 aoe o arcane_explosion Fluffy_Pillow 11752.1/63371: 19% mana rune_of_power
3:47.570 aoe o arcane_explosion Fluffy_Pillow 8408.6/63371: 13% mana arcane_charge, clearcasting, rune_of_power
3:48.877 aoe o arcane_explosion Fluffy_Pillow 10065.2/63371: 16% mana arcane_charge(2), rune_of_power
3:50.183 aoe o arcane_explosion Fluffy_Pillow 6720.4/63371: 11% mana arcane_charge(3), clearcasting, rune_of_power
3:51.490 aoe p arcane_barrage Fluffy_Pillow 8376.9/63371: 13% mana arcane_charge(4), rune_of_power
3:52.795 aoe m arcane_orb Fluffy_Pillow 12565.8/63371: 20% mana rune_of_power
3:54.100 aoe n shifting_power Fluffy_Pillow 13719.8/63371: 22% mana arcane_charge(4)
3:57.754 aoe p arcane_barrage Fluffy_Pillow 15851.0/63371: 25% mana arcane_charge(4)
3:59.060 aoe o arcane_explosion Fluffy_Pillow 20041.1/63371: 32% mana
4:00.366 aoe o arcane_explosion Fluffy_Pillow 16696.4/63371: 26% mana arcane_charge
4:01.673 aoe o arcane_explosion Fluffy_Pillow 13352.9/63371: 21% mana arcane_charge(2), clearcasting
4:02.978 aoe o arcane_explosion Fluffy_Pillow 15006.9/63371: 24% mana arcane_charge(3)
4:04.285 aoe p arcane_barrage Fluffy_Pillow 11663.4/63371: 18% mana arcane_charge(4)
4:05.592 aoe m arcane_orb Fluffy_Pillow 15854.8/63371: 25% mana
4:06.897 aoe p arcane_barrage Fluffy_Pillow 17008.8/63371: 27% mana arcane_charge(4)
4:08.203 aoe o arcane_explosion Fluffy_Pillow 21198.9/63371: 33% mana
4:09.511 aoe o arcane_explosion Fluffy_Pillow 17856.7/63371: 28% mana arcane_charge
4:10.817 aoe j touch_of_the_magi Fluffy_Pillow 14512.0/63371: 23% mana arcane_charge(2)
4:12.125 aoe l rune_of_power Fluffy_Pillow 13669.8/63371: 22% mana arcane_charge(4)
4:13.432 aoe p arcane_barrage Fluffy_Pillow 15326.3/63371: 24% mana arcane_charge(4), rune_of_power
4:14.740 aoe o arcane_explosion Fluffy_Pillow 19518.9/63371: 31% mana rune_of_power
4:16.047 aoe o arcane_explosion Fluffy_Pillow 16175.5/63371: 26% mana arcane_charge, rune_of_power
4:17.354 aoe o arcane_explosion Fluffy_Pillow 12832.0/63371: 20% mana arcane_charge(2), clearcasting, rune_of_power
4:18.661 aoe o arcane_explosion Fluffy_Pillow 14488.5/63371: 23% mana arcane_charge(3), rune_of_power
4:19.967 aoe p arcane_barrage Fluffy_Pillow 11143.8/63371: 18% mana arcane_charge(4), rune_of_power
4:21.274 aoe o arcane_explosion Fluffy_Pillow 15335.2/63371: 24% mana rune_of_power
4:22.582 shared_cds r use_mana_gem NightFae_Dream 11993.0/63371: 19% mana arcane_charge, rune_of_power
4:22.653 aoe o arcane_explosion Fluffy_Pillow 18420.1/63371: 29% mana arcane_charge, rune_of_power
4:23.961 aoe o arcane_explosion Fluffy_Pillow 15077.9/63371: 24% mana arcane_charge(2), rune_of_power
4:25.266 aoe o arcane_explosion Fluffy_Pillow 11731.9/63371: 19% mana arcane_charge(3), rune_of_power
4:26.572 aoe p arcane_barrage Fluffy_Pillow 8387.2/63371: 13% mana arcane_charge(4), clearcasting, rune_of_power
4:27.877 aoe m arcane_orb Fluffy_Pillow 12576.0/63371: 20% mana clearcasting, rune_of_power
4:29.182 aoe p arcane_barrage Fluffy_Pillow 13730.0/63371: 22% mana arcane_charge(4), clearcasting(2)
4:30.490 aoe o arcane_explosion Fluffy_Pillow 17922.7/63371: 28% mana clearcasting(2)
4:31.798 aoe o arcane_explosion Fluffy_Pillow 19580.5/63371: 31% mana arcane_charge, clearcasting
4:33.105 aoe o arcane_explosion Fluffy_Pillow 21237.0/63371: 34% mana arcane_charge(2)
4:34.412 aoe o arcane_explosion Fluffy_Pillow 17893.5/63371: 28% mana arcane_charge(3)
4:35.718 aoe p arcane_barrage Fluffy_Pillow 14548.8/63371: 23% mana arcane_charge(4)
4:37.025 aoe o arcane_explosion Fluffy_Pillow 18740.2/63371: 30% mana
4:38.332 aoe o arcane_explosion Fluffy_Pillow 15396.7/63371: 24% mana arcane_charge
4:39.640 aoe n shifting_power Fluffy_Pillow 12054.5/63371: 19% mana arcane_charge(2)
4:43.441 aoe o arcane_explosion Fluffy_Pillow 14372.0/63371: 23% mana arcane_charge(2)
4:44.747 aoe o arcane_explosion Fluffy_Pillow 11027.2/63371: 17% mana arcane_charge(3), clearcasting
4:46.053 aoe p arcane_barrage Fluffy_Pillow 12682.5/63371: 20% mana arcane_charge(4)
4:47.360 aoe m arcane_orb Fluffy_Pillow 16873.9/63371: 27% mana
4:48.667 aoe p arcane_barrage Fluffy_Pillow 18030.4/63371: 28% mana arcane_charge(4)
4:49.974 aoe o arcane_explosion Fluffy_Pillow 22221.8/63371: 35% mana
4:51.280 aoe j touch_of_the_magi Fluffy_Pillow 18877.1/63371: 30% mana arcane_charge
4:52.586 aoe k arcane_power Fluffy_Pillow 18032.3/63371: 28% mana arcane_charge(4)
4:52.586 aoe p arcane_barrage Fluffy_Pillow 18032.3/63371: 28% mana arcane_charge(4), arcane_power, rune_of_power
4:53.894 aoe o arcane_explosion Fluffy_Pillow 22225.0/63371: 35% mana arcane_power, rune_of_power
4:55.200 aoe o arcane_explosion Fluffy_Pillow 21380.3/63371: 34% mana arcane_charge, arcane_power, rune_of_power
4:56.506 aoe o arcane_explosion Fluffy_Pillow 20535.5/63371: 32% mana arcane_charge(2), arcane_power, rune_of_power
4:57.813 aoe o arcane_explosion Fluffy_Pillow 19692.0/63371: 31% mana arcane_charge(3), arcane_power, rune_of_power
4:59.121 aoe p arcane_barrage Fluffy_Pillow 18849.8/63371: 30% mana arcane_charge(4), arcane_power, rune_of_power
5:00.427 aoe o arcane_explosion Fluffy_Pillow 23040.0/63371: 36% mana arcane_power, rune_of_power
5:01.734 shared_cds s potion Fluffy_Pillow 22196.5/63371: 35% mana arcane_charge, arcane_power, rune_of_power
5:01.734 aoe o arcane_explosion Fluffy_Pillow 22196.5/63371: 35% mana arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
5:03.040 aoe o arcane_explosion Fluffy_Pillow 21351.7/63371: 34% mana arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
5:04.346 aoe o arcane_explosion Fluffy_Pillow 20507.0/63371: 32% mana arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
5:05.653 aoe p arcane_barrage Fluffy_Pillow 19663.5/63371: 31% mana arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
5:06.960 aoe o arcane_explosion Fluffy_Pillow 23854.9/63371: 38% mana arcane_power, rune_of_power, potion_of_deathly_fixation
5:08.266 aoe o arcane_explosion Fluffy_Pillow 23010.2/63371: 36% mana arcane_charge, potion_of_deathly_fixation
5:09.573 aoe o arcane_explosion Fluffy_Pillow 19666.7/63371: 31% mana arcane_charge(2), potion_of_deathly_fixation
5:10.879 aoe o arcane_explosion Fluffy_Pillow 16322.0/63371: 26% mana arcane_charge(3), potion_of_deathly_fixation
5:12.186 aoe l rune_of_power Fluffy_Pillow 12978.5/63371: 20% mana arcane_charge(4), potion_of_deathly_fixation
5:13.491 aoe p arcane_barrage Fluffy_Pillow 14632.5/63371: 23% mana arcane_charge(4), rune_of_power, potion_of_deathly_fixation
5:14.797 aoe m arcane_orb Fluffy_Pillow 18822.6/63371: 30% mana rune_of_power, potion_of_deathly_fixation
5:16.102 aoe p arcane_barrage Fluffy_Pillow 19976.6/63371: 32% mana arcane_charge(4), rune_of_power, potion_of_deathly_fixation
5:17.408 aoe o arcane_explosion Fluffy_Pillow 24166.7/63371: 38% mana rune_of_power, potion_of_deathly_fixation
5:18.715 aoe o arcane_explosion Fluffy_Pillow 20823.3/63371: 33% mana arcane_charge, clearcasting, rune_of_power, potion_of_deathly_fixation
5:20.021 aoe o arcane_explosion Fluffy_Pillow 22478.5/63371: 35% mana arcane_charge(2), rune_of_power, potion_of_deathly_fixation
5:21.327 aoe o arcane_explosion Fluffy_Pillow 19133.8/63371: 30% mana arcane_charge(3), rune_of_power, potion_of_deathly_fixation
5:22.634 aoe p arcane_barrage Fluffy_Pillow 15790.3/63371: 25% mana arcane_charge(4), rune_of_power, potion_of_deathly_fixation
5:23.940 aoe o arcane_explosion Fluffy_Pillow 19980.4/63371: 32% mana rune_of_power, potion_of_deathly_fixation
5:25.246 aoe o arcane_explosion Fluffy_Pillow 16635.7/63371: 26% mana arcane_charge, rune_of_power, potion_of_deathly_fixation
5:26.552 aoe o arcane_explosion Fluffy_Pillow 13291.0/63371: 21% mana arcane_charge(2), rune_of_power, potion_of_deathly_fixation
5:27.860 aoe o arcane_explosion Fluffy_Pillow 9948.8/63371: 16% mana arcane_charge(3), clearcasting, rune_of_power
5:29.167 aoe n shifting_power Fluffy_Pillow 11605.3/63371: 18% mana arcane_charge(4)
5:32.850 aoe p arcane_barrage Fluffy_Pillow 13773.2/63371: 22% mana arcane_charge(4)
5:34.157 aoe m arcane_orb Fluffy_Pillow 17964.6/63371: 28% mana
5:35.465 aoe p arcane_barrage Fluffy_Pillow 19122.4/63371: 30% mana arcane_charge(4)
5:36.771 aoe o arcane_explosion Fluffy_Pillow 23312.5/63371: 37% mana
5:38.078 aoe o arcane_explosion Fluffy_Pillow 19969.1/63371: 32% mana arcane_charge
5:39.385 aoe o arcane_explosion Fluffy_Pillow 16625.6/63371: 26% mana arcane_charge(2)
5:40.692 aoe o arcane_explosion Fluffy_Pillow 13282.1/63371: 21% mana arcane_charge(3)
5:41.999 aoe p arcane_barrage Fluffy_Pillow 9938.6/63371: 16% mana arcane_charge(4), clearcasting
5:43.305 aoe o arcane_explosion Fluffy_Pillow 14128.8/63371: 22% mana clearcasting
5:44.612 aoe o arcane_explosion Fluffy_Pillow 15785.3/63371: 25% mana arcane_charge
5:45.918 aoe j touch_of_the_magi Fluffy_Pillow 12440.6/63371: 20% mana arcane_charge(2), clearcasting
5:47.225 aoe l rune_of_power Fluffy_Pillow 11597.1/63371: 18% mana arcane_charge(4), clearcasting
5:48.530 aoe p arcane_barrage Fluffy_Pillow 13251.1/63371: 21% mana arcane_charge(4), clearcasting, rune_of_power
5:49.837 aoe o arcane_explosion Fluffy_Pillow 17442.5/63371: 28% mana clearcasting, rune_of_power
5:51.144 aoe o arcane_explosion Fluffy_Pillow 19099.0/63371: 30% mana arcane_charge, rune_of_power
5:52.451 aoe o arcane_explosion Fluffy_Pillow 15755.5/63371: 25% mana arcane_charge(2), rune_of_power
5:53.757 aoe o arcane_explosion Fluffy_Pillow 12410.8/63371: 20% mana arcane_charge(3), rune_of_power
5:55.062 aoe p arcane_barrage Fluffy_Pillow 9064.8/63371: 14% mana arcane_charge(4), clearcasting, rune_of_power
5:56.368 aoe m arcane_orb Fluffy_Pillow 13254.9/63371: 21% mana clearcasting, rune_of_power

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="NightFae_Dream"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=night_fae
soulbind=arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

NightFae_Dream_SB : 10434 dps, 4207 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
10433.6 10433.6 10.3 / 0.098% 790.4 / 7.6% 5.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
1886.4 1786.1 Mana 0.00% 47.9 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Dream_SB 10434
Arcane Barrage 2860 27.4% 54.4 5.56sec 15814 12772 Direct 163.0 4421 8867 5278 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.43 163.05 0.00 0.00 1.2381 0.0000 860662.47 860662.47 0.00% 12772.32 12772.32
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.71% 131.59 90 169 4420.89 2082 11222 4421.99 3971 4747 581796 581796 0.00%
crit 19.29% 31.46 16 53 8866.88 4164 22444 8862.06 6250 12003 278866 278866 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:54.43
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 293 2.8% 41.5 6.89sec 2125 0 Direct 124.5 593 1188 708 19.4%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.49 124.48 0.00 0.00 0.0000 0.0000 88167.27 88167.27 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 100.38 71 133 593.23 443 682 593.19 568 621 59546 59546 0.00%
crit 19.36% 24.10 10 40 1187.95 886 1364 1187.85 1017 1321 28621 28621 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 5124 49.1% 143.1 2.07sec 10780 8667 Direct 429.3 3015 6014 3593 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 143.11 429.32 0.00 0.00 1.2438 0.0000 1542668.58 1542668.58 0.00% 8666.77 8666.77
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 346.53 266 433 3014.75 2128 4588 3014.48 2906 3129 1044750 1044750 0.00%
crit 19.28% 82.79 49 126 6014.26 4256 9177 6012.85 5229 6638 497919 497919 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.546000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 54.6%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:143.09
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (893) 0.0% (8.5%) 13.9 22.36sec 19296 15624

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.91 0.00 0.00 0.00 1.2350 0.0000 0.00 0.00 0.00% 15624.26 15624.26

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.91
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 893 8.5% 41.6 22.36sec 6444 0 Direct 41.6 5404 10838 6443 19.1%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.65 41.65 0.00 0.00 0.0000 0.0000 268362.22 268362.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.88% 33.68 21 47 5403.97 3869 8342 5414.63 4829 6227 182046 182046 0.00%
crit 19.12% 7.96 1 21 10837.53 7739 16685 10856.19 7739 16685 86317 86317 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (87) 0.0% (0.8%) 18.9 9.18sec 1409 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.89 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 87 0.8% 18.9 9.18sec 1409 0 Direct 18.9 1181 2363 1409 19.3%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.89 18.89 0.00 0.00 0.0000 0.0000 26624.68 26624.68 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.71% 15.25 5 29 1181.31 1164 1195 1181.36 1170 1195 18014 18014 0.00%
crit 19.29% 3.64 0 13 2362.72 2327 2389 2285.18 0 2389 8610 8610 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1520 3040 1848 21.6%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1848.55 1848.55 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.40% 0.78 0 1 1520.16 1520 1520 1191.77 0 1520 1192 1192 0.00%
crit 21.60% 0.22 0 1 3040.32 3040 3040 656.77 0 3040 657 657 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (21) 0.0% (0.2%) 1.0 0.00sec 6112 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 153  / 21 0.2% 90.0 1.29sec 68 52 Direct 90.0 57 114 68 19.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6111.95 6111.95 0.00% 51.89 51.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 72.69 59 85 56.97 43 62 56.97 56 58 4141 4141 0.00%
crit 19.24% 17.31 5 31 113.86 86 124 113.86 101 123 1971 1971 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Shifting Power 392 3.8% 6.0 49.52sec 19843 5560 Periodic 71.1 1394 2788 1663 19.3% 2.2%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.96 0.00 23.68 71.05 3.5688 0.8342 118183.51 118183.51 0.00% 5560.27 5560.27
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.70% 57.34 40 77 1394.28 1372 1409 1394.12 1387 1400 79953 79953 0.00%
crit 19.30% 13.71 4 28 2788.36 2745 2818 2787.96 2745 2818 38231 38231 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:5.96
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (757) 0.0% (7.3%) 6.6 49.15sec 34606 26490

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.59 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 26490.00 26490.00

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.63
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 757 7.3% 6.6 48.99sec 34606 0 Direct 19.7 11589 0 11589 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.59 19.67 0.00 0.00 0.0000 0.0000 227946.49 227946.49 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 19.67 15 24 11589.21 1517 41664 11610.24 9561 14858 227946 227946 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17499.60
  • base_dd_max:17499.60
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Dream_SB
Arcane Power 3.6 97.18sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.58 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.58
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.61sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.3 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.26 0.00 1.54 0.00 4.2810 0.7216 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.26
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.46sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.49
  • if_expr:buff.arcane_power.up
Rune of Power 6.4 48.01sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.40 0.00 0.00 0.00 1.2596 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.42
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 120.57sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.81 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.81
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 55.2 150.1 5.5sec 1.5sec 4.2sec 76.32% 0.00% 3.5 (5.4) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 16.0s
  • trigger_min/max:0.0s / 9.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.6s

Stack Uptimes

  • arcane_charge_1:21.32%
  • arcane_charge_2:18.91%
  • arcane_charge_3:14.52%
  • arcane_charge_4:21.57%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 97.2sec 97.2sec 14.7sec 17.48% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 102.1s
  • trigger_min/max:96.0s / 102.1s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s

Stack Uptimes

  • arcane_power_1:17.48%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 194.7sec 194.7sec 12.0sec 8.07% 23.61% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:192.6s / 199.2s
  • trigger_min/max:192.6s / 199.2s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.07%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.46% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.46%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.4 0.2 13.0sec 12.8sec 2.2sec 16.31% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.07%
  • clearcasting_2:0.25%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.3 0.0 0.0sec 0.0sec 4.3sec 0.37% 0.00% 1.0 (1.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:0.38%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.5 0.0 300.5sec 300.5sec 23.3sec 11.35% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 301.1s
  • trigger_min/max:300.0s / 301.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.35%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 10.0 0.0 31.5sec 31.5sec 14.6sec 48.44% 0.00% 0.0 (0.0) 9.5

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:16.8s / 48.7s
  • trigger_min/max:16.8s / 48.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:48.44%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Social Butterfly 30.6 0.0 10.0sec 10.0sec 5.0sec 50.41% 0.00% 0.0 (0.0) 30.1

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_social_butterfly
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 10.0s
  • trigger_min/max:10.0s / 10.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.0s

Stack Uptimes

  • social_butterfly_1:50.41%

Spelldata

  • id:320130
  • name:Social Butterfly
  • tooltip:Versatility increased by $w1%.
  • description:{$@spelldesc319210=When at least {$s3=2} allies are within {$s4=8} yd, your Versatility increases by {$320130s1=3}% for {$320130d=5 seconds}. When this expires, {$s3=2} nearby allies gain ${{$320212s1=1}/{$320130s1=3}*100}% of this effect for {$320212d=5 seconds} before passing it back to you.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.59% 0.76% 6.81% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 301.2s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000205.223144.154263.984
Evocation222.79993.151353.895286.532166.468359.984
Rune of Power14.2530.01236.59694.26776.520116.256
Touch of the Magi10.8770.00022.64474.11357.30696.880
Arcane Power1.2330.0036.0824.4192.4618.962
Arcane Barrage3.0420.00012.287166.851132.596202.194
Arcane Orb4.6170.00012.61564.77147.60882.171
Shifting Power9.3290.00033.25155.66450.20763.477

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Dream_SB
mana_regen Mana 687.51 374110.98 69.54% 544.15 7114.76 1.87%
Evocation Mana 12.33 12401.45 2.31% 1005.84 0.00 0.00%
Mana Gem Mana 2.81 17829.65 3.31% 6337.14 0.00 0.00%
Arcane Barrage Mana 54.43 133658.52 24.84% 2455.63 4312.48 3.13%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1786.10 1886.36 11436.9 33168.3 1053.2 63371.4
Usage Type Count Total Avg RPE APR
NightFae_Dream_SB
arcane_explosion Mana 143.1 529597.1 3701.1 3700.7 2.9
arcane_orb Mana 13.9 6200.9 445.9 445.9 43.3
shifting_power Mana 6.0 14891.2 2500.0 2500.2 7.9
touch_of_the_magi Mana 6.6 16478.2 2500.0 2501.6 13.8

Statistics & Data Analysis

Fight Length
NightFae_Dream_SB Fight Length
Count 1523
Mean 301.22
Minimum 240.15
Maximum 359.98
Spread ( max - min ) 119.83
Range [ ( max - min ) / 2 * 100% ] 19.89%
DPS
NightFae_Dream_SB Damage Per Second
Count 1523
Mean 10433.57
Minimum 9717.96
Maximum 11157.28
Spread ( max - min ) 1439.32
Range [ ( max - min ) / 2 * 100% ] 6.90%
Standard Deviation 204.2241
5th Percentile 10104.48
95th Percentile 10761.28
( 95th Percentile - 5th Percentile ) 656.80
Mean Distribution
Standard Deviation 5.2331
95.00% Confidence Interval ( 10423.31 - 10443.83 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1472
0.1 Scale Factor Error with Delta=300 357
0.05 Scale Factor Error with Delta=300 1425
0.01 Scale Factor Error with Delta=300 35604
Priority Target DPS
NightFae_Dream_SB Priority Target Damage Per Second
Count 1523
Mean 4206.63
Minimum 3826.99
Maximum 4855.83
Spread ( max - min ) 1028.84
Range [ ( max - min ) / 2 * 100% ] 12.23%
Standard Deviation 124.1496
5th Percentile 4008.76
95th Percentile 4415.93
( 95th Percentile - 5th Percentile ) 407.17
Mean Distribution
Standard Deviation 3.1812
95.00% Confidence Interval ( 4200.39 - 4212.86 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 34
0.1% Error 3346
0.1 Scale Factor Error with Delta=300 132
0.05 Scale Factor Error with Delta=300 527
0.01 Scale Factor Error with Delta=300 13158
DPS(e)
NightFae_Dream_SB Damage Per Second (Effective)
Count 1523
Mean 10433.57
Minimum 9717.96
Maximum 11157.28
Spread ( max - min ) 1439.32
Range [ ( max - min ) / 2 * 100% ] 6.90%
Damage
NightFae_Dream_SB Damage
Count 1523
Mean 3134463.77
Minimum 2468445.56
Maximum 3808347.53
Spread ( max - min ) 1339901.97
Range [ ( max - min ) / 2 * 100% ] 21.37%
DTPS
NightFae_Dream_SB Damage Taken Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Dream_SB Healing Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Dream_SB Healing Per Second (Effective)
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Dream_SB Heal
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Dream_SB Healing Taken Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Dream_SB Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_Dream_SBTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Dream_SB Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.63 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.58 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.42 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.91 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 5.96 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 143.09 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 54.43 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.26 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.81 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.49 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjkstpmpoooopoooopoooolpoooorpmpoooopoonoopmpoooopoojlpoooopmpoooopoooopoonoopmpoooopojkpoooopoooopmlpoooopooooponooopmporooopjlpoooopoooopmpooooponooopmpoooopjktpoooopoooopmpoooolpoooopoooopmnpoooopmpoojlpoooopooroopmpoooopoonoopmpojkpooooposooopoooolpmpoooopoooonpmpoooopoojlpoooopm

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask NightFae_Dream_SB 63371.4/63371: 100% mana
Pre precombat R food NightFae_Dream_SB 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana social_butterfly
0:01.308 aoe k arcane_power Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, arcane_charge(4), social_butterfly
0:01.308 shared_cds s potion Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, social_butterfly
0:01.308 shared_cds t berserking Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:01.308 aoe p arcane_barrage Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:02.222 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:03.135 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:04.050 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:04.965 aoe o arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:05.880 aoe o arcane_explosion Fluffy_Pillow 60690.8/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.795 aoe o arcane_explosion Fluffy_Pillow 59350.5/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.710 aoe p arcane_barrage Fluffy_Pillow 58010.2/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.625 aoe o arcane_explosion Fluffy_Pillow 61704.8/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.539 aoe o arcane_explosion Fluffy_Pillow 60363.2/63371: 95% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.453 aoe o arcane_explosion Fluffy_Pillow 59021.6/63371: 93% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:11.368 aoe o arcane_explosion Fluffy_Pillow 57681.3/63371: 91% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:12.283 aoe p arcane_barrage Fluffy_Pillow 56341.0/63371: 89% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:13.198 aoe o arcane_explosion Fluffy_Pillow 60035.6/63371: 95% mana bloodlust, berserking, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:14.111 aoe o arcane_explosion Fluffy_Pillow 58692.7/63371: 93% mana bloodlust, arcane_charge, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:15.117 aoe o arcane_explosion Fluffy_Pillow 57467.8/63371: 91% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:16.122 aoe o arcane_explosion Fluffy_Pillow 56241.5/63371: 89% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:17.130 aoe l rune_of_power Fluffy_Pillow 55019.1/63371: 87% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:18.138 aoe p arcane_barrage Fluffy_Pillow 56296.7/63371: 89% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:19.146 aoe o arcane_explosion Fluffy_Pillow 60109.1/63371: 95% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:20.155 aoe o arcane_explosion Fluffy_Pillow 56387.9/63371: 89% mana bloodlust, arcane_charge, clearcasting, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:21.162 aoe o arcane_explosion Fluffy_Pillow 57664.2/63371: 91% mana bloodlust, arcane_charge(2), rune_of_power, social_butterfly, potion_of_deathly_fixation
0:22.169 aoe o arcane_explosion Fluffy_Pillow 53940.5/63371: 85% mana bloodlust, arcane_charge(3), rune_of_power, social_butterfly, potion_of_deathly_fixation
0:23.174 shared_cds r use_mana_gem NightFae_Dream_SB 50214.3/63371: 79% mana bloodlust, arcane_charge(4), rune_of_power, social_butterfly, potion_of_deathly_fixation
0:23.174 aoe p arcane_barrage Fluffy_Pillow 56551.4/63371: 89% mana bloodlust, arcane_charge(4), rune_of_power, social_butterfly, potion_of_deathly_fixation
0:24.181 aoe m arcane_orb Fluffy_Pillow 60362.6/63371: 95% mana bloodlust, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:25.188 aoe p arcane_barrage Fluffy_Pillow 61138.9/63371: 96% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:26.193 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:27.200 aoe o arcane_explosion Fluffy_Pillow 59647.7/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:28.207 aoe o arcane_explosion Fluffy_Pillow 55924.0/63371: 88% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power
0:29.213 aoe o arcane_explosion Fluffy_Pillow 57199.1/63371: 90% mana bloodlust, arcane_charge(3), rune_of_power
0:30.220 aoe p arcane_barrage Fluffy_Pillow 53475.4/63371: 84% mana bloodlust, arcane_charge(4), rune_of_power, social_butterfly
0:31.227 aoe o arcane_explosion Fluffy_Pillow 57286.5/63371: 90% mana bloodlust, rune_of_power, social_butterfly
0:32.233 aoe o arcane_explosion Fluffy_Pillow 53561.6/63371: 85% mana bloodlust, arcane_charge, rune_of_power, social_butterfly
0:33.240 aoe n shifting_power Fluffy_Pillow 49837.9/63371: 79% mana bloodlust, arcane_charge(2), social_butterfly
0:36.202 aoe o arcane_explosion Fluffy_Pillow 51092.0/63371: 81% mana bloodlust, arcane_charge(2)
0:37.209 aoe o arcane_explosion Fluffy_Pillow 47368.3/63371: 75% mana bloodlust, arcane_charge(3)
0:38.216 aoe p arcane_barrage Fluffy_Pillow 43644.6/63371: 69% mana bloodlust, arcane_charge(4)
0:39.223 aoe m arcane_orb Fluffy_Pillow 47455.7/63371: 75% mana bloodlust
0:40.229 aoe p arcane_barrage Fluffy_Pillow 48230.8/63371: 76% mana bloodlust, arcane_charge(4), social_butterfly
0:41.236 aoe o arcane_explosion Fluffy_Pillow 52041.9/63371: 82% mana social_butterfly
0:42.543 aoe o arcane_explosion Fluffy_Pillow 48698.5/63371: 77% mana arcane_charge, clearcasting, social_butterfly
0:43.849 aoe o arcane_explosion Fluffy_Pillow 50353.7/63371: 79% mana arcane_charge(2), social_butterfly
0:45.156 aoe o arcane_explosion Fluffy_Pillow 47010.2/63371: 74% mana arcane_charge(3)
0:46.462 aoe p arcane_barrage Fluffy_Pillow 43665.5/63371: 69% mana arcane_charge(4)
0:47.768 aoe o arcane_explosion Fluffy_Pillow 47855.6/63371: 76% mana
0:49.075 aoe o arcane_explosion Fluffy_Pillow 44512.2/63371: 70% mana arcane_charge
0:50.380 aoe j touch_of_the_magi Fluffy_Pillow 41166.2/63371: 65% mana arcane_charge(2), clearcasting, social_butterfly
0:51.685 aoe l rune_of_power Fluffy_Pillow 40320.1/63371: 64% mana arcane_charge(4), clearcasting, social_butterfly
0:52.993 aoe p arcane_barrage Fluffy_Pillow 41977.9/63371: 66% mana arcane_charge(4), clearcasting, rune_of_power, social_butterfly
0:54.299 aoe o arcane_explosion Fluffy_Pillow 46168.1/63371: 73% mana clearcasting, rune_of_power, social_butterfly
0:55.607 aoe o arcane_explosion Fluffy_Pillow 47825.9/63371: 75% mana arcane_charge, rune_of_power
0:56.914 aoe o arcane_explosion Fluffy_Pillow 44482.4/63371: 70% mana arcane_charge(2), rune_of_power
0:58.221 aoe o arcane_explosion Fluffy_Pillow 41138.9/63371: 65% mana arcane_charge(3), clearcasting, rune_of_power
0:59.527 aoe p arcane_barrage Fluffy_Pillow 42794.2/63371: 68% mana arcane_charge(4), rune_of_power
1:00.835 aoe m arcane_orb Fluffy_Pillow 46986.8/63371: 74% mana rune_of_power, social_butterfly
1:02.140 aoe p arcane_barrage Fluffy_Pillow 48140.8/63371: 76% mana arcane_charge(4), rune_of_power, social_butterfly
1:03.448 aoe o arcane_explosion Fluffy_Pillow 52333.5/63371: 83% mana rune_of_power, social_butterfly
1:04.755 aoe o arcane_explosion Fluffy_Pillow 48990.0/63371: 77% mana arcane_charge, rune_of_power, social_butterfly
1:06.060 aoe o arcane_explosion Fluffy_Pillow 45644.0/63371: 72% mana arcane_charge(2), rune_of_power
1:07.366 aoe o arcane_explosion Fluffy_Pillow 42299.3/63371: 67% mana arcane_charge(3), rune_of_power
1:08.672 aoe p arcane_barrage Fluffy_Pillow 38954.5/63371: 61% mana arcane_charge(4)
1:09.979 aoe o arcane_explosion Fluffy_Pillow 43145.9/63371: 68% mana
1:11.286 aoe o arcane_explosion Fluffy_Pillow 39802.4/63371: 63% mana arcane_charge, social_butterfly
1:12.593 aoe o arcane_explosion Fluffy_Pillow 36459.0/63371: 58% mana arcane_charge(2), social_butterfly
1:13.900 aoe o arcane_explosion Fluffy_Pillow 33115.5/63371: 52% mana arcane_charge(3), social_butterfly
1:15.206 aoe p arcane_barrage Fluffy_Pillow 29770.8/63371: 47% mana arcane_charge(4), clearcasting
1:16.512 aoe o arcane_explosion Fluffy_Pillow 33960.9/63371: 54% mana clearcasting
1:17.818 aoe o arcane_explosion Fluffy_Pillow 35616.1/63371: 56% mana arcane_charge
1:19.124 aoe n shifting_power Fluffy_Pillow 32271.4/63371: 51% mana arcane_charge(2)
1:22.782 aoe o arcane_explosion Fluffy_Pillow 34407.7/63371: 54% mana arcane_charge(2), social_butterfly
1:24.088 aoe o arcane_explosion Fluffy_Pillow 31062.9/63371: 49% mana arcane_charge(3), social_butterfly
1:25.394 aoe p arcane_barrage Fluffy_Pillow 27718.2/63371: 44% mana arcane_charge(4)
1:26.700 aoe m arcane_orb Fluffy_Pillow 31908.3/63371: 50% mana
1:28.005 aoe p arcane_barrage Fluffy_Pillow 33062.3/63371: 52% mana arcane_charge(4)
1:29.313 aoe o arcane_explosion Fluffy_Pillow 37254.9/63371: 59% mana
1:30.618 aoe o arcane_explosion Fluffy_Pillow 33908.9/63371: 54% mana arcane_charge, social_butterfly
1:31.925 aoe o arcane_explosion Fluffy_Pillow 30565.5/63371: 48% mana arcane_charge(2), social_butterfly
1:33.233 aoe o arcane_explosion Fluffy_Pillow 27223.3/63371: 43% mana arcane_charge(3), social_butterfly
1:34.538 aoe p arcane_barrage Fluffy_Pillow 23877.3/63371: 38% mana arcane_charge(4), social_butterfly
1:35.844 aoe o arcane_explosion Fluffy_Pillow 28067.4/63371: 44% mana
1:37.152 aoe j touch_of_the_magi Fluffy_Pillow 24725.2/63371: 39% mana arcane_charge
1:38.457 aoe k arcane_power Fluffy_Pillow 23879.2/63371: 38% mana arcane_charge(4)
1:38.457 aoe p arcane_barrage Fluffy_Pillow 23879.2/63371: 38% mana arcane_charge(4), arcane_power, rune_of_power
1:39.763 aoe o arcane_explosion Fluffy_Pillow 28069.3/63371: 44% mana arcane_power, rune_of_power
1:41.069 aoe o arcane_explosion Fluffy_Pillow 27224.6/63371: 43% mana arcane_charge, arcane_power, rune_of_power, social_butterfly
1:42.376 aoe o arcane_explosion Fluffy_Pillow 26381.1/63371: 42% mana arcane_charge(2), arcane_power, rune_of_power, social_butterfly
1:43.682 aoe o arcane_explosion Fluffy_Pillow 25536.3/63371: 40% mana arcane_charge(3), arcane_power, clearcasting, rune_of_power, social_butterfly
1:44.988 aoe p arcane_barrage Fluffy_Pillow 27191.6/63371: 43% mana arcane_charge(4), arcane_power, rune_of_power, social_butterfly
1:46.295 aoe o arcane_explosion Fluffy_Pillow 31383.0/63371: 50% mana arcane_power, rune_of_power
1:47.600 aoe o arcane_explosion Fluffy_Pillow 30537.0/63371: 48% mana arcane_charge, arcane_power, rune_of_power
1:48.907 aoe o arcane_explosion Fluffy_Pillow 29693.5/63371: 47% mana arcane_charge(2), arcane_power, rune_of_power
1:50.213 aoe o arcane_explosion Fluffy_Pillow 28848.8/63371: 46% mana arcane_charge(3), arcane_power, rune_of_power, social_butterfly
1:51.519 aoe p arcane_barrage Fluffy_Pillow 28004.0/63371: 44% mana arcane_charge(4), arcane_power, rune_of_power, social_butterfly
1:52.826 aoe m arcane_orb Fluffy_Pillow 32195.4/63371: 51% mana arcane_power, rune_of_power, social_butterfly
1:54.132 aoe l rune_of_power Fluffy_Pillow 33600.7/63371: 53% mana arcane_charge(4), clearcasting, social_butterfly
1:55.439 aoe p arcane_barrage Fluffy_Pillow 35257.2/63371: 56% mana arcane_charge(4), clearcasting, rune_of_power
1:56.745 aoe o arcane_explosion Fluffy_Pillow 39447.3/63371: 62% mana clearcasting, rune_of_power
1:58.053 aoe o arcane_explosion Fluffy_Pillow 41105.1/63371: 65% mana arcane_charge, rune_of_power
1:59.361 aoe o arcane_explosion Fluffy_Pillow 37762.9/63371: 60% mana arcane_charge(2), rune_of_power
2:00.667 aoe o arcane_explosion Fluffy_Pillow 34418.2/63371: 54% mana arcane_charge(3), rune_of_power, social_butterfly
2:01.973 aoe p arcane_barrage Fluffy_Pillow 31073.5/63371: 49% mana arcane_charge(4), rune_of_power, social_butterfly
2:03.279 aoe o arcane_explosion Fluffy_Pillow 35263.6/63371: 56% mana rune_of_power, social_butterfly
2:04.587 aoe o arcane_explosion Fluffy_Pillow 31921.4/63371: 50% mana arcane_charge, rune_of_power, social_butterfly
2:05.894 aoe o arcane_explosion Fluffy_Pillow 28577.9/63371: 45% mana arcane_charge(2), rune_of_power
2:07.199 aoe o arcane_explosion Fluffy_Pillow 25231.9/63371: 40% mana arcane_charge(3), clearcasting, rune_of_power
2:08.506 aoe p arcane_barrage Fluffy_Pillow 26888.4/63371: 42% mana arcane_charge(4), rune_of_power
2:09.814 aoe o arcane_explosion Fluffy_Pillow 31081.1/63371: 49% mana rune_of_power
2:11.119 aoe n shifting_power Fluffy_Pillow 27735.1/63371: 44% mana arcane_charge, social_butterfly
2:14.856 aoe o arcane_explosion Fluffy_Pillow 29971.4/63371: 47% mana arcane_charge, social_butterfly
2:16.164 aoe o arcane_explosion Fluffy_Pillow 26629.2/63371: 42% mana arcane_charge(2)
2:17.470 aoe o arcane_explosion Fluffy_Pillow 23284.5/63371: 37% mana arcane_charge(3)
2:18.777 aoe p arcane_barrage Fluffy_Pillow 19941.0/63371: 31% mana arcane_charge(4)
2:20.084 aoe m arcane_orb Fluffy_Pillow 24132.4/63371: 38% mana social_butterfly
2:21.389 aoe p arcane_barrage Fluffy_Pillow 25286.4/63371: 40% mana arcane_charge(4), social_butterfly
2:22.695 aoe o arcane_explosion Fluffy_Pillow 29476.5/63371: 47% mana social_butterfly
2:24.000 shared_cds r use_mana_gem NightFae_Dream_SB 26130.5/63371: 41% mana arcane_charge, social_butterfly
2:24.000 aoe o arcane_explosion Fluffy_Pillow 32467.7/63371: 51% mana arcane_charge, social_butterfly
2:25.307 aoe o arcane_explosion Fluffy_Pillow 29124.2/63371: 46% mana arcane_charge(2)
2:26.613 aoe o arcane_explosion Fluffy_Pillow 25779.5/63371: 41% mana arcane_charge(3)
2:27.920 aoe p arcane_barrage Fluffy_Pillow 22436.0/63371: 35% mana arcane_charge(4)
2:29.225 aoe j touch_of_the_magi Fluffy_Pillow 26624.8/63371: 42% mana
2:30.533 aoe l rune_of_power Fluffy_Pillow 25782.6/63371: 41% mana arcane_charge(4), social_butterfly
2:31.839 aoe p arcane_barrage Fluffy_Pillow 27437.9/63371: 43% mana arcane_charge(4), rune_of_power, social_butterfly
2:33.147 aoe o arcane_explosion Fluffy_Pillow 31630.6/63371: 50% mana rune_of_power, social_butterfly
2:34.454 aoe o arcane_explosion Fluffy_Pillow 28287.1/63371: 45% mana arcane_charge, rune_of_power, social_butterfly
2:35.761 aoe o arcane_explosion Fluffy_Pillow 24943.6/63371: 39% mana arcane_charge(2), rune_of_power
2:37.067 aoe o arcane_explosion Fluffy_Pillow 21598.9/63371: 34% mana arcane_charge(3), rune_of_power
2:38.374 aoe p arcane_barrage Fluffy_Pillow 18255.4/63371: 29% mana arcane_charge(4), clearcasting, rune_of_power
2:39.679 aoe o arcane_explosion Fluffy_Pillow 22444.3/63371: 35% mana clearcasting, rune_of_power
2:40.986 aoe o arcane_explosion Fluffy_Pillow 24100.8/63371: 38% mana arcane_charge, rune_of_power, social_butterfly
2:42.293 aoe o arcane_explosion Fluffy_Pillow 20757.3/63371: 33% mana arcane_charge(2), rune_of_power, social_butterfly
2:43.600 aoe o arcane_explosion Fluffy_Pillow 17413.8/63371: 27% mana arcane_charge(3), rune_of_power, social_butterfly
2:44.905 aoe p arcane_barrage Fluffy_Pillow 14067.8/63371: 22% mana arcane_charge(4), rune_of_power, social_butterfly
2:46.210 aoe m arcane_orb Fluffy_Pillow 18256.7/63371: 29% mana rune_of_power
2:47.516 aoe p arcane_barrage Fluffy_Pillow 19412.0/63371: 31% mana arcane_charge(4)
2:48.822 aoe o arcane_explosion Fluffy_Pillow 23602.1/63371: 37% mana
2:50.127 aoe o arcane_explosion Fluffy_Pillow 20256.1/63371: 32% mana arcane_charge, social_butterfly
2:51.435 aoe o arcane_explosion Fluffy_Pillow 16913.9/63371: 27% mana arcane_charge(2), social_butterfly
2:52.742 aoe o arcane_explosion Fluffy_Pillow 13570.4/63371: 21% mana arcane_charge(3), clearcasting, social_butterfly
2:54.049 aoe p arcane_barrage Fluffy_Pillow 15226.9/63371: 24% mana arcane_charge(4), social_butterfly
2:55.356 aoe o arcane_explosion Fluffy_Pillow 19418.3/63371: 31% mana
2:56.663 aoe n shifting_power Fluffy_Pillow 16074.8/63371: 25% mana arcane_charge
3:00.338 aoe o arcane_explosion Fluffy_Pillow 18232.6/63371: 29% mana arcane_charge, social_butterfly
3:01.643 aoe o arcane_explosion Fluffy_Pillow 14886.6/63371: 23% mana arcane_charge(2), social_butterfly
3:02.949 aoe o arcane_explosion Fluffy_Pillow 11541.9/63371: 18% mana arcane_charge(3), clearcasting, social_butterfly
3:04.255 aoe p arcane_barrage Fluffy_Pillow 13197.2/63371: 21% mana arcane_charge(4), social_butterfly
3:05.563 aoe m arcane_orb Fluffy_Pillow 17389.8/63371: 27% mana
3:06.868 aoe p arcane_barrage Fluffy_Pillow 18543.8/63371: 29% mana arcane_charge(4)
3:08.175 aoe o arcane_explosion Fluffy_Pillow 22735.2/63371: 36% mana
3:09.479 aoe o arcane_explosion Fluffy_Pillow 19387.9/63371: 31% mana arcane_charge, clearcasting
3:10.786 aoe o arcane_explosion Fluffy_Pillow 21044.4/63371: 33% mana arcane_charge(2), social_butterfly
3:12.092 aoe o arcane_explosion Fluffy_Pillow 17699.7/63371: 28% mana arcane_charge(3), social_butterfly
3:13.399 aoe p arcane_barrage Fluffy_Pillow 14356.2/63371: 23% mana arcane_charge(4), social_butterfly
3:14.704 aoe j touch_of_the_magi Fluffy_Pillow 18545.1/63371: 29% mana social_butterfly
3:16.010 aoe k arcane_power Fluffy_Pillow 17700.3/63371: 28% mana arcane_charge(4), clearcasting
3:16.010 shared_cds t berserking Fluffy_Pillow 17700.3/63371: 28% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power
3:16.010 aoe p arcane_barrage Fluffy_Pillow 17700.3/63371: 28% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power
3:17.198 aoe o arcane_explosion Fluffy_Pillow 21740.9/63371: 34% mana berserking, arcane_power, clearcasting, rune_of_power
3:18.386 aoe o arcane_explosion Fluffy_Pillow 23246.6/63371: 37% mana berserking, arcane_charge, arcane_power, rune_of_power
3:19.576 aoe o arcane_explosion Fluffy_Pillow 22254.9/63371: 35% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:20.764 aoe o arcane_explosion Fluffy_Pillow 21260.6/63371: 34% mana berserking, arcane_charge(3), arcane_power, rune_of_power, social_butterfly
3:21.952 aoe p arcane_barrage Fluffy_Pillow 20266.3/63371: 32% mana berserking, arcane_charge(4), arcane_power, rune_of_power, social_butterfly
3:23.142 aoe o arcane_explosion Fluffy_Pillow 24309.4/63371: 38% mana berserking, arcane_power, rune_of_power, social_butterfly
3:24.332 aoe o arcane_explosion Fluffy_Pillow 23317.6/63371: 37% mana berserking, arcane_charge, arcane_power, rune_of_power, social_butterfly
3:25.522 aoe o arcane_explosion Fluffy_Pillow 22325.8/63371: 35% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:26.711 aoe o arcane_explosion Fluffy_Pillow 21332.8/63371: 34% mana berserking, arcane_charge(3), arcane_power, rune_of_power
3:27.900 aoe p arcane_barrage Fluffy_Pillow 20339.8/63371: 32% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:29.088 aoe m arcane_orb Fluffy_Pillow 24380.3/63371: 38% mana arcane_power, rune_of_power
3:30.394 aoe p arcane_barrage Fluffy_Pillow 25785.6/63371: 41% mana arcane_charge(4), arcane_power, rune_of_power, social_butterfly
3:31.800 aoe o arcane_explosion Fluffy_Pillow 30102.5/63371: 48% mana social_butterfly
3:33.105 aoe o arcane_explosion Fluffy_Pillow 26756.5/63371: 42% mana arcane_charge, social_butterfly
3:34.412 aoe o arcane_explosion Fluffy_Pillow 23413.0/63371: 37% mana arcane_charge(2), social_butterfly
3:35.718 aoe o arcane_explosion Fluffy_Pillow 20068.3/63371: 32% mana arcane_charge(3)
3:37.027 aoe l rune_of_power Fluffy_Pillow 16727.3/63371: 26% mana arcane_charge(4)
3:38.333 aoe p arcane_barrage Fluffy_Pillow 18382.6/63371: 29% mana arcane_charge(4), rune_of_power
3:39.639 aoe o arcane_explosion Fluffy_Pillow 22572.7/63371: 36% mana rune_of_power
3:40.946 aoe o arcane_explosion Fluffy_Pillow 19229.2/63371: 30% mana arcane_charge, rune_of_power, social_butterfly
3:42.254 aoe o arcane_explosion Fluffy_Pillow 15887.0/63371: 25% mana arcane_charge(2), rune_of_power, social_butterfly
3:43.560 aoe o arcane_explosion Fluffy_Pillow 12542.3/63371: 20% mana arcane_charge(3), rune_of_power, social_butterfly
3:44.867 aoe p arcane_barrage Fluffy_Pillow 9198.8/63371: 15% mana arcane_charge(4), clearcasting, rune_of_power, social_butterfly
3:46.174 aoe o arcane_explosion Fluffy_Pillow 13390.2/63371: 21% mana clearcasting, rune_of_power
3:47.479 aoe o arcane_explosion Fluffy_Pillow 15044.2/63371: 24% mana arcane_charge, rune_of_power
3:48.786 aoe o arcane_explosion Fluffy_Pillow 11700.7/63371: 18% mana arcane_charge(2), rune_of_power
3:50.093 aoe o arcane_explosion Fluffy_Pillow 8357.3/63371: 13% mana arcane_charge(3), rune_of_power, social_butterfly
3:51.400 aoe p arcane_barrage Fluffy_Pillow 5013.8/63371: 8% mana arcane_charge(4), rune_of_power, social_butterfly
3:52.707 aoe m arcane_orb Fluffy_Pillow 9205.2/63371: 15% mana rune_of_power, social_butterfly
3:54.016 aoe n shifting_power Fluffy_Pillow 10364.2/63371: 16% mana arcane_charge(4), social_butterfly
3:57.732 aoe p arcane_barrage Fluffy_Pillow 12574.0/63371: 20% mana arcane_charge(4)
3:59.041 aoe o arcane_explosion Fluffy_Pillow 16767.9/63371: 26% mana
4:00.346 aoe o arcane_explosion Fluffy_Pillow 13421.9/63371: 21% mana arcane_charge, social_butterfly
4:01.654 aoe o arcane_explosion Fluffy_Pillow 10079.7/63371: 16% mana arcane_charge(2), social_butterfly
4:02.961 aoe o arcane_explosion Fluffy_Pillow 6736.2/63371: 11% mana arcane_charge(3), clearcasting, social_butterfly
4:04.267 aoe p arcane_barrage Fluffy_Pillow 8391.5/63371: 13% mana arcane_charge(4), social_butterfly
4:05.573 aoe m arcane_orb Fluffy_Pillow 12581.6/63371: 20% mana
4:06.879 aoe p arcane_barrage Fluffy_Pillow 13736.9/63371: 22% mana arcane_charge(4)
4:08.185 aoe o arcane_explosion Fluffy_Pillow 17927.0/63371: 28% mana
4:09.492 aoe o arcane_explosion Fluffy_Pillow 14583.5/63371: 23% mana arcane_charge
4:10.799 aoe j touch_of_the_magi Fluffy_Pillow 11240.1/63371: 18% mana arcane_charge(2), social_butterfly
4:12.107 aoe l rune_of_power Fluffy_Pillow 10397.9/63371: 16% mana arcane_charge(4), clearcasting, social_butterfly
4:13.414 aoe p arcane_barrage Fluffy_Pillow 12054.4/63371: 19% mana arcane_charge(4), clearcasting, rune_of_power, social_butterfly
4:14.720 aoe o arcane_explosion Fluffy_Pillow 16244.5/63371: 26% mana clearcasting, rune_of_power, social_butterfly
4:16.026 aoe o arcane_explosion Fluffy_Pillow 17899.8/63371: 28% mana arcane_charge, rune_of_power
4:17.334 aoe o arcane_explosion Fluffy_Pillow 14557.6/63371: 23% mana arcane_charge(2), rune_of_power
4:18.640 aoe o arcane_explosion Fluffy_Pillow 11212.8/63371: 18% mana arcane_charge(3), clearcasting, rune_of_power
4:19.946 aoe p arcane_barrage Fluffy_Pillow 12868.1/63371: 20% mana arcane_charge(4), rune_of_power
4:21.253 aoe o arcane_explosion Fluffy_Pillow 17059.5/63371: 27% mana rune_of_power, social_butterfly
4:22.559 aoe o arcane_explosion Fluffy_Pillow 13714.7/63371: 22% mana arcane_charge, rune_of_power, social_butterfly
4:23.864 shared_cds r use_mana_gem NightFae_Dream_SB 10368.7/63371: 16% mana arcane_charge(2), clearcasting, rune_of_power, social_butterfly
4:24.000 aoe o arcane_explosion Fluffy_Pillow 16878.2/63371: 27% mana arcane_charge(2), clearcasting, rune_of_power, social_butterfly
4:25.307 aoe o arcane_explosion Fluffy_Pillow 18534.8/63371: 29% mana arcane_charge(3), rune_of_power
4:26.616 aoe p arcane_barrage Fluffy_Pillow 15193.8/63371: 24% mana arcane_charge(4), clearcasting, rune_of_power
4:27.924 aoe m arcane_orb Fluffy_Pillow 19386.5/63371: 31% mana clearcasting, rune_of_power
4:29.230 aoe p arcane_barrage Fluffy_Pillow 20541.8/63371: 32% mana arcane_charge(4), clearcasting
4:30.537 aoe o arcane_explosion Fluffy_Pillow 24733.1/63371: 39% mana clearcasting, social_butterfly
4:31.845 aoe o arcane_explosion Fluffy_Pillow 26390.9/63371: 42% mana arcane_charge, social_butterfly
4:33.152 aoe o arcane_explosion Fluffy_Pillow 23047.5/63371: 36% mana arcane_charge(2), social_butterfly
4:34.458 aoe o arcane_explosion Fluffy_Pillow 19702.7/63371: 31% mana arcane_charge(3), social_butterfly
4:35.765 aoe p arcane_barrage Fluffy_Pillow 16359.3/63371: 26% mana arcane_charge(4)
4:37.071 aoe o arcane_explosion Fluffy_Pillow 20549.4/63371: 32% mana
4:38.378 aoe o arcane_explosion Fluffy_Pillow 17205.9/63371: 27% mana arcane_charge
4:39.685 aoe n shifting_power Fluffy_Pillow 13862.4/63371: 22% mana arcane_charge(2)
4:43.533 aoe o arcane_explosion Fluffy_Pillow 16239.5/63371: 26% mana arcane_charge(2), social_butterfly
4:44.839 aoe o arcane_explosion Fluffy_Pillow 12894.8/63371: 20% mana arcane_charge(3), social_butterfly
4:46.148 aoe p arcane_barrage Fluffy_Pillow 9553.8/63371: 15% mana arcane_charge(4)
4:47.455 aoe m arcane_orb Fluffy_Pillow 13745.2/63371: 22% mana
4:48.761 aoe p arcane_barrage Fluffy_Pillow 14900.5/63371: 24% mana arcane_charge(4)
4:50.069 aoe o arcane_explosion Fluffy_Pillow 19093.1/63371: 30% mana social_butterfly
4:51.376 aoe j touch_of_the_magi Fluffy_Pillow 15749.7/63371: 25% mana arcane_charge, social_butterfly
4:52.682 aoe k arcane_power Fluffy_Pillow 14904.9/63371: 24% mana arcane_charge(4), social_butterfly
4:52.682 aoe p arcane_barrage Fluffy_Pillow 14904.9/63371: 24% mana arcane_charge(4), arcane_power, rune_of_power, social_butterfly
4:53.986 aoe o arcane_explosion Fluffy_Pillow 19092.5/63371: 30% mana arcane_power, rune_of_power, social_butterfly
4:55.293 aoe o arcane_explosion Fluffy_Pillow 18249.0/63371: 29% mana arcane_charge, arcane_power, rune_of_power
4:56.599 aoe o arcane_explosion Fluffy_Pillow 17404.3/63371: 27% mana arcane_charge(2), arcane_power, rune_of_power
4:57.906 aoe o arcane_explosion Fluffy_Pillow 16560.8/63371: 26% mana arcane_charge(3), arcane_power, rune_of_power
4:59.213 aoe p arcane_barrage Fluffy_Pillow 15717.3/63371: 25% mana arcane_charge(4), arcane_power, rune_of_power
5:00.519 aoe o arcane_explosion Fluffy_Pillow 19907.5/63371: 31% mana arcane_power, rune_of_power, social_butterfly
5:01.827 shared_cds s potion Fluffy_Pillow 19065.3/63371: 30% mana arcane_charge, arcane_power, rune_of_power, social_butterfly
5:01.827 aoe o arcane_explosion Fluffy_Pillow 19065.3/63371: 30% mana arcane_charge, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
5:03.132 aoe o arcane_explosion Fluffy_Pillow 18219.3/63371: 29% mana arcane_charge(2), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
5:04.439 aoe o arcane_explosion Fluffy_Pillow 17375.8/63371: 27% mana arcane_charge(3), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
5:05.746 aoe p arcane_barrage Fluffy_Pillow 16532.3/63371: 26% mana arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
5:07.052 aoe o arcane_explosion Fluffy_Pillow 20722.4/63371: 33% mana arcane_power, rune_of_power, potion_of_deathly_fixation
5:08.359 aoe o arcane_explosion Fluffy_Pillow 19879.0/63371: 31% mana arcane_charge, potion_of_deathly_fixation
5:09.665 aoe o arcane_explosion Fluffy_Pillow 16534.2/63371: 26% mana arcane_charge(2), potion_of_deathly_fixation
5:10.970 aoe o arcane_explosion Fluffy_Pillow 13188.2/63371: 21% mana arcane_charge(3), social_butterfly, potion_of_deathly_fixation
5:12.276 aoe l rune_of_power Fluffy_Pillow 9843.5/63371: 16% mana arcane_charge(4), clearcasting, social_butterfly, potion_of_deathly_fixation
5:13.583 aoe p arcane_barrage Fluffy_Pillow 11500.0/63371: 18% mana arcane_charge(4), clearcasting, rune_of_power, social_butterfly, potion_of_deathly_fixation
5:14.889 aoe m arcane_orb Fluffy_Pillow 15690.1/63371: 25% mana clearcasting, rune_of_power, social_butterfly, potion_of_deathly_fixation
5:16.197 aoe p arcane_barrage Fluffy_Pillow 16847.9/63371: 27% mana arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
5:17.503 aoe o arcane_explosion Fluffy_Pillow 21038.0/63371: 33% mana clearcasting, rune_of_power, potion_of_deathly_fixation
5:18.807 aoe o arcane_explosion Fluffy_Pillow 22690.8/63371: 36% mana arcane_charge, rune_of_power, potion_of_deathly_fixation
5:20.113 aoe o arcane_explosion Fluffy_Pillow 19346.0/63371: 31% mana arcane_charge(2), rune_of_power, social_butterfly, potion_of_deathly_fixation
5:21.421 aoe o arcane_explosion Fluffy_Pillow 16003.8/63371: 25% mana arcane_charge(3), clearcasting, rune_of_power, social_butterfly, potion_of_deathly_fixation
5:22.728 aoe p arcane_barrage Fluffy_Pillow 17660.4/63371: 28% mana arcane_charge(4), rune_of_power, social_butterfly, potion_of_deathly_fixation
5:24.035 aoe o arcane_explosion Fluffy_Pillow 21851.7/63371: 34% mana rune_of_power, social_butterfly, potion_of_deathly_fixation
5:25.341 aoe o arcane_explosion Fluffy_Pillow 18507.0/63371: 29% mana arcane_charge, clearcasting, rune_of_power, potion_of_deathly_fixation
5:26.649 aoe o arcane_explosion Fluffy_Pillow 20164.8/63371: 32% mana arcane_charge(2), rune_of_power, potion_of_deathly_fixation
5:27.957 aoe o arcane_explosion Fluffy_Pillow 16822.6/63371: 27% mana arcane_charge(3), rune_of_power
5:29.265 aoe n shifting_power Fluffy_Pillow 13480.4/63371: 21% mana arcane_charge(4), clearcasting
5:33.021 aoe p arcane_barrage Fluffy_Pillow 15740.9/63371: 25% mana arcane_charge(4), clearcasting, social_butterfly
5:34.327 aoe m arcane_orb Fluffy_Pillow 19931.0/63371: 31% mana clearcasting, social_butterfly
5:35.634 aoe p arcane_barrage Fluffy_Pillow 21087.5/63371: 33% mana arcane_charge(4), clearcasting
5:36.940 aoe o arcane_explosion Fluffy_Pillow 25277.6/63371: 40% mana clearcasting
5:38.246 aoe o arcane_explosion Fluffy_Pillow 26932.9/63371: 43% mana arcane_charge
5:39.552 aoe o arcane_explosion Fluffy_Pillow 23588.1/63371: 37% mana arcane_charge(2)
5:40.857 aoe o arcane_explosion Fluffy_Pillow 20242.1/63371: 32% mana arcane_charge(3), clearcasting, social_butterfly
5:42.163 aoe p arcane_barrage Fluffy_Pillow 21897.4/63371: 35% mana arcane_charge(4), social_butterfly
5:43.469 aoe o arcane_explosion Fluffy_Pillow 26087.5/63371: 41% mana social_butterfly
5:44.773 aoe o arcane_explosion Fluffy_Pillow 22740.3/63371: 36% mana arcane_charge, social_butterfly
5:46.079 aoe j touch_of_the_magi Fluffy_Pillow 19395.5/63371: 31% mana arcane_charge(2)
5:47.386 aoe l rune_of_power Fluffy_Pillow 18552.0/63371: 29% mana arcane_charge(4), clearcasting
5:48.691 aoe p arcane_barrage Fluffy_Pillow 20206.0/63371: 32% mana arcane_charge(4), clearcasting, rune_of_power
5:49.997 aoe o arcane_explosion Fluffy_Pillow 24396.2/63371: 38% mana clearcasting, rune_of_power
5:51.302 aoe o arcane_explosion Fluffy_Pillow 26050.1/63371: 41% mana arcane_charge, rune_of_power, social_butterfly
5:52.609 aoe o arcane_explosion Fluffy_Pillow 22706.7/63371: 36% mana arcane_charge(2), rune_of_power, social_butterfly
5:53.916 aoe o arcane_explosion Fluffy_Pillow 19363.2/63371: 31% mana arcane_charge(3), rune_of_power, social_butterfly
5:55.223 aoe p arcane_barrage Fluffy_Pillow 16019.7/63371: 25% mana arcane_charge(4), rune_of_power
5:56.530 aoe m arcane_orb Fluffy_Pillow 20211.1/63371: 32% mana rune_of_power

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="NightFae_Dream_SB"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=night_fae
soulbind=319210//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

NightFae_Niya : 10513 dps, 4233 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
10512.6 10512.6 9.8 / 0.093% 752.5 / 7.2% 5.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
1894.6 1808.7 Mana 0.00% 48.0 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Niya 10513
Arcane Barrage 2871 27.3% 54.6 5.53sec 15831 12784 Direct 163.5 4428 8850 5283 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.58 163.53 0.00 0.00 1.2383 0.0000 864084.01 864084.01 0.00% 12784.20 12784.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 131.89 97 170 4427.55 2082 11386 4427.15 4061 4814 583858 583858 0.00%
crit 19.35% 31.64 12 52 8849.82 4164 22696 8853.85 5776 11976 280226 280226 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:54.59
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 289 2.8% 41.5 6.88sec 2098 0 Direct 124.6 586 1170 700 19.4%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.53 124.59 0.00 0.00 0.0000 0.0000 87146.81 87146.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.59% 100.41 68 133 586.14 443 664 586.13 561 614 58850 58850 0.00%
crit 19.41% 24.18 11 41 1170.37 886 1329 1170.46 1019 1329 28297 28297 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 5189 49.4% 143.5 2.07sec 10885 8750 Direct 430.5 3043 6076 3628 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 143.51 430.53 0.00 0.00 1.2440 0.0000 1562137.80 1562137.80 0.00% 8750.30 8750.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 347.41 270 434 3042.77 2128 4782 3042.17 2934 3142 1057120 1057120 0.00%
crit 19.31% 83.12 50 125 6075.68 4256 9565 6074.20 5490 6830 505018 505018 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.546000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 54.6%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:143.49
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (903) 0.0% (8.6%) 14.0 22.20sec 19386 15691

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.99 0.00 0.00 0.00 1.2356 0.0000 0.00 0.00 0.00% 15690.78 15690.78

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.99
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 903 8.6% 41.9 22.19sec 6473 0 Direct 41.9 5439 10854 6473 19.1%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.91 41.91 0.00 0.00 0.0000 0.0000 271293.51 271293.51 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.90% 33.90 21 47 5439.26 3869 8505 5450.47 4939 6041 184438 184438 0.00%
crit 19.10% 8.01 1 17 10853.83 7739 17011 10874.59 7956 15358 86856 86856 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (86) 0.0% (0.8%) 18.8 9.01sec 1389 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 86 0.8% 18.8 9.01sec 1389 0 Direct 18.8 1164 2327 1389 19.4%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.85 18.85 0.00 0.00 0.0000 0.0000 26179.07 26179.07 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.63% 15.20 6 29 1163.53 1164 1164 1163.53 1164 1164 17682 17682 0.00%
crit 19.37% 3.65 0 11 2327.06 2327 2327 2264.42 0 2327 8497 8497 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1766 19.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1765.53 1765.53 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 0.81 0 1 1480.68 1481 1481 1195.82 0 1481 1196 1196 0.00%
crit 19.24% 0.19 0 1 2961.35 2961 2961 569.72 0 2961 570 570 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 6043 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 151  / 20 0.2% 90.0 1.29sec 67 51 Direct 90.0 56 113 67 19.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6043.28 6043.28 0.00% 51.31 51.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.59% 72.53 55 83 56.21 43 60 56.21 55 58 4077 4077 0.00%
crit 19.41% 17.47 7 35 112.55 86 120 112.55 100 120 1966 1966 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Shifting Power 386 3.7% 6.0 49.58sec 19533 5471 Periodic 71.0 1372 2745 1636 19.3% 2.2%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.95 0.00 23.67 71.02 3.5700 0.8342 116246.87 116246.87 0.00% 5471.47 5471.47
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.73% 57.34 35 77 1372.31 1372 1372 1372.31 1372 1372 78689 78689 0.00%
crit 19.27% 13.68 4 28 2744.61 2745 2745 2744.61 2745 2745 37558 37558 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:5.95
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (763) 0.0% (7.3%) 6.6 49.16sec 34863 26687

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.59 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 26687.04 26687.04

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.63
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 763 7.3% 6.6 48.98sec 34863 0 Direct 19.7 11672 0 11672 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.59 19.67 0.00 0.00 0.0000 0.0000 229641.94 229641.94 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 19.67 15 24 11671.64 1547 41397 11691.24 9579 14541 229642 229642 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17780.72
  • base_dd_max:17780.72
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Niya
Arcane Power 3.6 97.19sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.58 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.58
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.78sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.1 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.06 0.00 0.37 0.00 4.2530 0.7207 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.06
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.40sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.50
  • if_expr:buff.arcane_power.up
Rune of Power 6.4 48.11sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.39 0.00 0.00 0.00 1.2595 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.42
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 120.62sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.81 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.82
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 55.3 150.7 5.5sec 1.5sec 4.2sec 76.26% 0.00% 3.5 (5.5) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 16.1s
  • trigger_min/max:0.0s / 9.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.4s

Stack Uptimes

  • arcane_charge_1:21.31%
  • arcane_charge_2:18.98%
  • arcane_charge_3:14.26%
  • arcane_charge_4:21.72%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 97.2sec 97.2sec 14.7sec 17.49% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 102.1s
  • trigger_min/max:96.0s / 102.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:17.49%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 194.7sec 194.7sec 12.0sec 8.07% 23.61% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:193.4s / 199.3s
  • trigger_min/max:193.4s / 199.3s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.07%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.46% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.46%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.5 0.2 13.0sec 12.8sec 2.2sec 16.23% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.01%
  • clearcasting_2:0.22%
  • clearcasting_3:0.08%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.1 0.0 0.0sec 0.0sec 4.3sec 0.09% 0.00% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.5s / 4.3s

Stack Uptimes

  • evocation_1:0.11%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.5 0.0 300.4sec 300.4sec 23.3sec 11.35% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 301.0s
  • trigger_min/max:300.0s / 301.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.35%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Redirected Anima 16.9 0.0 53.1sec 16.8sec 66.8sec 83.93% 0.00% 0.0 (0.0) 2.9

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_redirected_anima
  • max_stacks:50
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:25.00

Trigger Details

  • interval_min/max:0.5s / 333.2s
  • trigger_min/max:0.3s / 57.5s
  • trigger_pct:98.42%
  • duration_min/max:0.1s / 333.9s

Stack Uptimes

  • redirected_anima_1:16.75%
  • redirected_anima_2:8.02%
  • redirected_anima_3:2.48%
  • redirected_anima_4:0.64%
  • redirected_anima_5:0.10%
  • redirected_anima_6:16.01%
  • redirected_anima_7:23.29%
  • redirected_anima_8:11.76%
  • redirected_anima_9:3.83%
  • redirected_anima_10:0.92%
  • redirected_anima_11:0.15%
  • redirected_anima_12:0.08%
  • redirected_anima_13:0.01%

Spelldata

  • id:342814
  • name:Redirected Anima
  • tooltip:Max health increased by $w1%. Mastery increased by $w2.
  • description:{$@spelldesc322721=Healing or dealing damage has a chance to grant you a stack of Redirected Anima. Redirected Anima increases your maximum health by {$342814s1=1}% and your Mastery by {$342814s2=25} for {$342814d=30 seconds}, and stacks overlap. $?(s152280&a137005)[Defile]?(a137005&!s152280)[Death's Due]?a212611[The Hunt]?a137009[Convoke the Spirits]?a137014[Wild Spirits]?a137018[Shifting Power]?a137022[Faeline Stomp]?a137026[Blessing of Seasons]?a137030[Fae Guardians]?a137034[Sepsis]?a137038[Fae Transfusion]?a137042[Soul Rot]?a137047[Ancient Aftershock][Activating your Night Fae class ability] grants you ${{$s3=8}*$<mod>} stacks of Redirected Anima.}
  • max_stacks:50
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 10.0 0.0 31.5sec 31.5sec 14.6sec 48.45% 0.00% 0.0 (0.0) 9.5

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:16.8s / 48.7s
  • trigger_min/max:16.8s / 48.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:48.45%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.58% 0.76% 6.62% 0.9s 0.0s 4.0s
Conserve Phase 100.00% 100.00% 100.00% 301.2s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000205.223144.154263.984
Evocation233.472124.513345.865297.876170.161359.984
Rune of Power14.2650.02336.61994.31676.601111.704
Touch of the Magi10.8600.00018.65474.00557.30192.752
Arcane Power1.2080.0046.0794.3282.8118.826
Arcane Barrage3.0250.00012.148166.436132.517200.480
Arcane Orb4.5630.00012.63364.41044.73278.917
Shifting Power9.3460.00033.25555.73150.29662.343

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Niya
mana_regen Mana 710.55 385464.89 70.75% 542.49 7152.62 1.82%
Evocation Mana 2.96 3037.58 0.56% 1026.08 0.00 0.00%
Mana Gem Mana 2.81 18378.82 3.37% 6530.83 0.00 0.00%
Arcane Barrage Mana 54.59 137961.17 25.32% 2527.37 4369.28 3.07%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1808.70 1894.58 11525.6 36430.4 1053.2 63371.4
Usage Type Count Total Avg RPE APR
NightFae_Niya
arcane_explosion Mana 143.5 532014.3 3707.6 3707.2 2.9
arcane_orb Mana 14.0 6244.5 446.2 446.2 43.4
shifting_power Mana 6.0 14879.8 2500.0 2500.2 7.8
touch_of_the_magi Mana 6.6 16478.2 2500.0 2501.6 13.9

Statistics & Data Analysis

Fight Length
NightFae_Niya Fight Length
Count 1523
Mean 301.22
Minimum 240.15
Maximum 359.98
Spread ( max - min ) 119.83
Range [ ( max - min ) / 2 * 100% ] 19.89%
DPS
NightFae_Niya Damage Per Second
Count 1523
Mean 10512.57
Minimum 9859.98
Maximum 11162.16
Spread ( max - min ) 1302.18
Range [ ( max - min ) / 2 * 100% ] 6.19%
Standard Deviation 194.2267
5th Percentile 10204.73
95th Percentile 10833.72
( 95th Percentile - 5th Percentile ) 628.99
Mean Distribution
Standard Deviation 4.9769
95.00% Confidence Interval ( 10502.82 - 10522.33 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1312
0.1 Scale Factor Error with Delta=300 323
0.05 Scale Factor Error with Delta=300 1289
0.01 Scale Factor Error with Delta=300 32204
Priority Target DPS
NightFae_Niya Priority Target Damage Per Second
Count 1523
Mean 4232.97
Minimum 3889.40
Maximum 4706.37
Spread ( max - min ) 816.97
Range [ ( max - min ) / 2 * 100% ] 9.65%
Standard Deviation 117.6571
5th Percentile 4051.01
95th Percentile 4426.23
( 95th Percentile - 5th Percentile ) 375.23
Mean Distribution
Standard Deviation 3.0149
95.00% Confidence Interval ( 4227.06 - 4238.88 )
Normalized 95.00% Confidence Interval ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 30
0.1% Error 2968
0.1 Scale Factor Error with Delta=300 119
0.05 Scale Factor Error with Delta=300 473
0.01 Scale Factor Error with Delta=300 11818
DPS(e)
NightFae_Niya Damage Per Second (Effective)
Count 1523
Mean 10512.57
Minimum 9859.98
Maximum 11162.16
Spread ( max - min ) 1302.18
Range [ ( max - min ) / 2 * 100% ] 6.19%
Damage
NightFae_Niya Damage
Count 1523
Mean 3158495.55
Minimum 2531645.50
Maximum 3864247.07
Spread ( max - min ) 1332601.57
Range [ ( max - min ) / 2 * 100% ] 21.10%
DTPS
NightFae_Niya Damage Taken Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Niya Healing Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Niya Healing Per Second (Effective)
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Niya Heal
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Niya Healing Taken Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Niya Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_NiyaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Niya Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.63 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.58 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.42 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.99 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 5.95 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 143.49 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 54.59 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.06 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.82 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.50 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjkstpmpoooopoooopoooolpoooropmpoooopoonoopmpoooopoojlpoooopmpoooopoooopoonoopmpoooopojkpoooopoooopmlpoooopooooponooopmproooopjlpoooopoooopmpooooponooopmpoooopjktpoooopoooopmpoooolpoooopoooopmnpoooopmpoojlpooooporooopmpoooopoonoopmpojkpooooposooopoooolpmpoooopoooonpmpoooopoojlpoooopm

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask NightFae_Niya 63371.4/63371: 100% mana
Pre precombat R food NightFae_Niya 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana
0:01.307 aoe k arcane_power Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4)
0:01.307 shared_cds s potion Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:01.307 shared_cds t berserking Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:01.307 aoe p arcane_barrage Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.221 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.136 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.050 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.963 aoe o arcane_explosion Fluffy_Pillow 62028.6/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.877 aoe o arcane_explosion Fluffy_Pillow 60687.0/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:06.793 aoe o arcane_explosion Fluffy_Pillow 61848.0/63371: 98% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.708 aoe p arcane_barrage Fluffy_Pillow 60507.7/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.623 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.539 aoe o arcane_explosion Fluffy_Pillow 62032.4/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.452 aoe o arcane_explosion Fluffy_Pillow 60689.6/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.364 aoe o arcane_explosion Fluffy_Pillow 59345.5/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:12.280 aoe p arcane_barrage Fluffy_Pillow 60506.4/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.196 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.111 aoe o arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:15.117 aoe o arcane_explosion Fluffy_Pillow 60806.2/63371: 96% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:16.122 aoe o arcane_explosion Fluffy_Pillow 59982.9/63800: 94% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:17.130 aoe l rune_of_power Fluffy_Pillow 58769.1/63800: 92% mana bloodlust, arcane_charge(4), redirected_anima, potion_of_deathly_fixation
0:18.136 aoe p arcane_barrage Fluffy_Pillow 60052.7/63800: 94% mana bloodlust, arcane_charge(4), rune_of_power, redirected_anima, potion_of_deathly_fixation
0:19.143 aoe o arcane_explosion Fluffy_Pillow 63800.0/63800: 100% mana bloodlust, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:20.149 aoe o arcane_explosion Fluffy_Pillow 60083.7/63800: 94% mana bloodlust, arcane_charge, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:21.155 aoe o arcane_explosion Fluffy_Pillow 56367.3/63800: 88% mana bloodlust, arcane_charge(2), rune_of_power, redirected_anima, potion_of_deathly_fixation
0:22.162 shared_cds r use_mana_gem NightFae_Niya 52652.2/63800: 83% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:22.162 aoe o arcane_explosion Fluffy_Pillow 59032.2/63800: 93% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:23.169 aoe p arcane_barrage Fluffy_Pillow 60317.2/63800: 95% mana bloodlust, arcane_charge(4), rune_of_power, redirected_anima, potion_of_deathly_fixation
0:24.175 aoe m arcane_orb Fluffy_Pillow 63800.0/63800: 100% mana bloodlust, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:25.182 aoe p arcane_barrage Fluffy_Pillow 63800.0/63800: 100% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:26.187 aoe o arcane_explosion Fluffy_Pillow 63800.0/63800: 100% mana bloodlust, clearcasting, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:27.193 aoe o arcane_explosion Fluffy_Pillow 63800.0/63800: 100% mana bloodlust, arcane_charge, rune_of_power, redirected_anima
0:28.199 aoe o arcane_explosion Fluffy_Pillow 60083.7/63800: 94% mana bloodlust, arcane_charge(2), rune_of_power, redirected_anima
0:29.205 aoe o arcane_explosion Fluffy_Pillow 56367.3/63800: 88% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, redirected_anima
0:30.213 aoe p arcane_barrage Fluffy_Pillow 57653.5/63800: 90% mana bloodlust, arcane_charge(4), rune_of_power, redirected_anima
0:31.219 aoe o arcane_explosion Fluffy_Pillow 61489.2/63800: 96% mana bloodlust, rune_of_power, redirected_anima
0:32.224 aoe o arcane_explosion Fluffy_Pillow 57771.6/63800: 91% mana bloodlust, arcane_charge, rune_of_power, redirected_anima
0:33.230 aoe n shifting_power Fluffy_Pillow 54055.2/63800: 85% mana bloodlust, arcane_charge(2), clearcasting, redirected_anima
0:36.167 aoe o arcane_explosion Fluffy_Pillow 57531.8/66371: 87% mana bloodlust, arcane_charge(2), clearcasting, redirected_anima(7)
0:37.175 aoe o arcane_explosion Fluffy_Pillow 58869.8/66371: 89% mana bloodlust, arcane_charge(3), redirected_anima(7)
0:38.183 aoe p arcane_barrage Fluffy_Pillow 55207.9/66371: 83% mana bloodlust, arcane_charge(4), redirected_anima(7)
0:39.190 aoe m arcane_orb Fluffy_Pillow 59199.5/66371: 89% mana bloodlust, redirected_anima(7)
0:40.197 aoe p arcane_barrage Fluffy_Pillow 60036.2/66371: 90% mana bloodlust, arcane_charge(4), redirected_anima(7)
0:41.204 aoe o arcane_explosion Fluffy_Pillow 64027.7/66371: 96% mana redirected_anima(7)
0:42.511 aoe o arcane_explosion Fluffy_Pillow 60762.7/66371: 92% mana arcane_charge, redirected_anima(7)
0:43.817 aoe o arcane_explosion Fluffy_Pillow 57496.3/66371: 87% mana arcane_charge(2), clearcasting, redirected_anima(7)
0:45.125 aoe o arcane_explosion Fluffy_Pillow 59232.6/66371: 89% mana arcane_charge(3), redirected_anima(7)
0:46.431 aoe p arcane_barrage Fluffy_Pillow 55604.8/65943: 84% mana arcane_charge(4), redirected_anima(6)
0:47.739 aoe o arcane_explosion Fluffy_Pillow 59967.6/65943: 91% mana redirected_anima(6)
0:49.047 aoe o arcane_explosion Fluffy_Pillow 56692.7/65943: 86% mana arcane_charge, redirected_anima(6)
0:50.353 aoe j touch_of_the_magi Fluffy_Pillow 53415.1/65943: 81% mana arcane_charge(2), redirected_anima(6)
0:51.659 aoe l rune_of_power Fluffy_Pillow 52637.5/65943: 80% mana arcane_charge(4), redirected_anima(6)
0:52.965 aoe p arcane_barrage Fluffy_Pillow 54360.0/65943: 82% mana arcane_charge(4), rune_of_power, redirected_anima(6)
0:54.272 aoe o arcane_explosion Fluffy_Pillow 58721.4/65943: 89% mana rune_of_power, redirected_anima(6)
0:55.579 aoe o arcane_explosion Fluffy_Pillow 55445.2/65943: 84% mana arcane_charge, clearcasting, rune_of_power, redirected_anima(6)
0:56.886 aoe o arcane_explosion Fluffy_Pillow 57168.9/65943: 87% mana arcane_charge(2), rune_of_power, redirected_anima(6)
0:58.193 aoe o arcane_explosion Fluffy_Pillow 53892.7/65943: 82% mana arcane_charge(3), rune_of_power, redirected_anima(6)
0:59.499 aoe p arcane_barrage Fluffy_Pillow 50615.1/65943: 77% mana arcane_charge(4), clearcasting, rune_of_power, redirected_anima(6)
1:00.805 aoe m arcane_orb Fluffy_Pillow 54975.2/65943: 83% mana clearcasting, rune_of_power, redirected_anima(6)
1:02.114 aoe p arcane_barrage Fluffy_Pillow 56201.6/65943: 85% mana arcane_charge(4), clearcasting, rune_of_power, redirected_anima(6)
1:03.420 aoe o arcane_explosion Fluffy_Pillow 58200.2/63371: 92% mana clearcasting, rune_of_power
1:04.726 aoe o arcane_explosion Fluffy_Pillow 59855.4/63371: 94% mana arcane_charge, rune_of_power
1:06.033 aoe o arcane_explosion Fluffy_Pillow 56512.0/63371: 89% mana arcane_charge(2), rune_of_power
1:07.340 aoe o arcane_explosion Fluffy_Pillow 53168.5/63371: 84% mana arcane_charge(3), rune_of_power
1:08.647 aoe p arcane_barrage Fluffy_Pillow 49825.0/63371: 79% mana arcane_charge(4)
1:09.953 aoe o arcane_explosion Fluffy_Pillow 54015.1/63371: 85% mana
1:11.260 aoe o arcane_explosion Fluffy_Pillow 50671.7/63371: 80% mana arcane_charge
1:12.566 aoe o arcane_explosion Fluffy_Pillow 47326.9/63371: 75% mana arcane_charge(2), clearcasting
1:13.873 aoe o arcane_explosion Fluffy_Pillow 48983.5/63371: 77% mana arcane_charge(3)
1:15.179 aoe p arcane_barrage Fluffy_Pillow 45638.7/63371: 72% mana arcane_charge(4)
1:16.487 aoe o arcane_explosion Fluffy_Pillow 49831.4/63371: 79% mana
1:17.794 aoe o arcane_explosion Fluffy_Pillow 46487.9/63371: 73% mana arcane_charge
1:19.100 aoe n shifting_power Fluffy_Pillow 43143.2/63371: 68% mana arcane_charge(2)
1:22.766 aoe o arcane_explosion Fluffy_Pillow 47127.3/65943: 71% mana arcane_charge(2), redirected_anima(6)
1:24.074 aoe o arcane_explosion Fluffy_Pillow 43852.3/65943: 67% mana arcane_charge(3), redirected_anima(6)
1:25.380 aoe p arcane_barrage Fluffy_Pillow 40574.8/65943: 62% mana arcane_charge(4), redirected_anima(6)
1:26.687 aoe m arcane_orb Fluffy_Pillow 44936.2/65943: 68% mana redirected_anima(6)
1:27.993 aoe p arcane_barrage Fluffy_Pillow 46158.6/65943: 70% mana arcane_charge(4), redirected_anima(6)
1:29.297 aoe o arcane_explosion Fluffy_Pillow 50516.2/65943: 77% mana redirected_anima(6)
1:30.603 aoe o arcane_explosion Fluffy_Pillow 47238.6/65943: 72% mana arcane_charge, redirected_anima(6)
1:31.912 aoe o arcane_explosion Fluffy_Pillow 44250.7/66371: 67% mana arcane_charge(2), clearcasting, redirected_anima(7)
1:33.217 aoe o arcane_explosion Fluffy_Pillow 45983.0/66371: 69% mana arcane_charge(3), redirected_anima(7)
1:34.523 aoe p arcane_barrage Fluffy_Pillow 42716.6/66371: 64% mana arcane_charge(4), redirected_anima(7)
1:35.830 aoe o arcane_explosion Fluffy_Pillow 47106.4/66371: 71% mana redirected_anima(7)
1:37.135 aoe j touch_of_the_magi Fluffy_Pillow 43838.7/66371: 66% mana arcane_charge, redirected_anima(7)
1:38.441 aoe k arcane_power Fluffy_Pillow 43072.3/66371: 65% mana arcane_charge(4), redirected_anima(7)
1:38.441 aoe p arcane_barrage Fluffy_Pillow 43072.3/66371: 65% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(7)
1:39.747 aoe o arcane_explosion Fluffy_Pillow 47460.8/66371: 72% mana arcane_power, rune_of_power, redirected_anima(7)
1:41.055 aoe o arcane_explosion Fluffy_Pillow 46697.1/66371: 70% mana arcane_charge, arcane_power, rune_of_power, redirected_anima(7)
1:42.361 aoe o arcane_explosion Fluffy_Pillow 45930.7/66371: 69% mana arcane_charge(2), arcane_power, rune_of_power, redirected_anima(7)
1:43.667 aoe o arcane_explosion Fluffy_Pillow 45164.3/66371: 68% mana arcane_charge(3), arcane_power, rune_of_power, redirected_anima(7)
1:44.973 aoe p arcane_barrage Fluffy_Pillow 44398.0/66371: 67% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, redirected_anima(7)
1:46.280 aoe o arcane_explosion Fluffy_Pillow 48787.8/66371: 74% mana arcane_power, clearcasting, rune_of_power, redirected_anima(7)
1:47.587 aoe o arcane_explosion Fluffy_Pillow 50522.7/66371: 76% mana arcane_charge, arcane_power, rune_of_power, redirected_anima(7)
1:48.893 aoe o arcane_explosion Fluffy_Pillow 49756.3/66371: 75% mana arcane_charge(2), arcane_power, rune_of_power, redirected_anima(7)
1:50.200 aoe o arcane_explosion Fluffy_Pillow 47093.2/63800: 74% mana arcane_charge(3), arcane_power, rune_of_power, redirected_anima
1:51.507 aoe p arcane_barrage Fluffy_Pillow 46260.9/63800: 73% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima
1:52.814 aoe m arcane_orb Fluffy_Pillow 50480.7/63800: 79% mana arcane_power, rune_of_power, redirected_anima
1:54.121 aoe l rune_of_power Fluffy_Pillow 51898.4/63800: 81% mana arcane_charge(4), redirected_anima
1:55.427 aoe p arcane_barrage Fluffy_Pillow 53564.9/63800: 84% mana arcane_charge(4), rune_of_power, redirected_anima
1:56.733 aoe o arcane_explosion Fluffy_Pillow 57783.3/63800: 91% mana rune_of_power, redirected_anima
1:58.040 aoe o arcane_explosion Fluffy_Pillow 54451.1/63800: 85% mana arcane_charge, rune_of_power, redirected_anima
1:59.346 aoe o arcane_explosion Fluffy_Pillow 51117.5/63800: 80% mana arcane_charge(2), rune_of_power, redirected_anima
2:00.651 aoe o arcane_explosion Fluffy_Pillow 47461.7/63371: 75% mana arcane_charge(3), clearcasting, rune_of_power
2:01.958 aoe p arcane_barrage Fluffy_Pillow 49118.2/63371: 78% mana arcane_charge(4), rune_of_power
2:03.265 aoe o arcane_explosion Fluffy_Pillow 53309.6/63371: 84% mana rune_of_power
2:04.571 aoe o arcane_explosion Fluffy_Pillow 49964.9/63371: 79% mana arcane_charge, rune_of_power
2:05.876 aoe o arcane_explosion Fluffy_Pillow 46618.9/63371: 74% mana arcane_charge(2), rune_of_power
2:07.183 aoe o arcane_explosion Fluffy_Pillow 43275.4/63371: 68% mana arcane_charge(3), clearcasting, rune_of_power
2:08.489 aoe p arcane_barrage Fluffy_Pillow 44930.7/63371: 71% mana arcane_charge(4), rune_of_power
2:09.795 aoe o arcane_explosion Fluffy_Pillow 49120.8/63371: 78% mana rune_of_power
2:11.100 aoe n shifting_power Fluffy_Pillow 45774.8/63371: 72% mana arcane_charge
2:14.770 aoe o arcane_explosion Fluffy_Pillow 49871.0/65943: 76% mana arcane_charge, redirected_anima(6)
2:16.075 aoe o arcane_explosion Fluffy_Pillow 46592.1/65943: 71% mana arcane_charge(2), redirected_anima(6)
2:17.381 aoe o arcane_explosion Fluffy_Pillow 43314.5/65943: 66% mana arcane_charge(3), redirected_anima(6)
2:18.686 aoe p arcane_barrage Fluffy_Pillow 40035.6/65943: 61% mana arcane_charge(4), redirected_anima(6)
2:19.992 aoe m arcane_orb Fluffy_Pillow 44395.7/65943: 67% mana redirected_anima(6)
2:21.299 aoe p arcane_barrage Fluffy_Pillow 45619.5/65943: 69% mana arcane_charge(4), redirected_anima(6)
2:22.606 shared_cds r use_mana_gem NightFae_Niya 49981.0/65943: 76% mana redirected_anima(6)
2:22.606 aoe o arcane_explosion Fluffy_Pillow 56575.2/65943: 86% mana redirected_anima(6)
2:23.913 aoe o arcane_explosion Fluffy_Pillow 53299.0/65943: 81% mana arcane_charge, redirected_anima(6)
2:25.219 aoe o arcane_explosion Fluffy_Pillow 50021.4/65943: 76% mana arcane_charge(2), redirected_anima(6)
2:26.525 aoe o arcane_explosion Fluffy_Pillow 46743.8/65943: 71% mana arcane_charge(3), redirected_anima(6)
2:27.834 aoe p arcane_barrage Fluffy_Pillow 43470.2/65943: 66% mana arcane_charge(4), redirected_anima(6)
2:29.141 aoe j touch_of_the_magi Fluffy_Pillow 47831.7/65943: 73% mana redirected_anima(6)
2:30.447 aoe l rune_of_power Fluffy_Pillow 47054.1/65943: 71% mana arcane_charge(4), clearcasting, redirected_anima(6)
2:31.753 aoe p arcane_barrage Fluffy_Pillow 48776.5/65943: 74% mana arcane_charge(4), clearcasting, rune_of_power, redirected_anima(6)
2:33.060 aoe o arcane_explosion Fluffy_Pillow 53138.0/65943: 81% mana clearcasting, rune_of_power, redirected_anima(6)
2:34.367 aoe o arcane_explosion Fluffy_Pillow 55218.3/66371: 83% mana arcane_charge, rune_of_power, redirected_anima(7)
2:35.670 aoe o arcane_explosion Fluffy_Pillow 51947.9/66371: 78% mana arcane_charge(2), rune_of_power, redirected_anima(7)
2:36.976 aoe o arcane_explosion Fluffy_Pillow 48681.6/66371: 73% mana arcane_charge(3), rune_of_power, redirected_anima(7)
2:38.282 aoe p arcane_barrage Fluffy_Pillow 45415.2/66371: 68% mana arcane_charge(4), rune_of_power, redirected_anima(7)
2:39.588 aoe o arcane_explosion Fluffy_Pillow 49803.7/66371: 75% mana rune_of_power, redirected_anima(7)
2:40.896 aoe o arcane_explosion Fluffy_Pillow 46539.9/66371: 70% mana arcane_charge, rune_of_power, redirected_anima(7)
2:42.203 aoe o arcane_explosion Fluffy_Pillow 41598.3/63800: 65% mana arcane_charge(2), rune_of_power, redirected_anima
2:43.511 aoe o arcane_explosion Fluffy_Pillow 38267.3/63800: 60% mana arcane_charge(3), rune_of_power, redirected_anima
2:44.817 aoe p arcane_barrage Fluffy_Pillow 34933.8/63800: 55% mana arcane_charge(4), rune_of_power, redirected_anima
2:46.122 aoe m arcane_orb Fluffy_Pillow 39150.9/63800: 61% mana rune_of_power, redirected_anima
2:47.427 aoe p arcane_barrage Fluffy_Pillow 40316.1/63800: 63% mana arcane_charge(4), redirected_anima
2:48.732 aoe o arcane_explosion Fluffy_Pillow 44533.3/63800: 70% mana redirected_anima
2:50.039 aoe o arcane_explosion Fluffy_Pillow 41201.0/63800: 65% mana arcane_charge, redirected_anima
2:51.346 aoe o arcane_explosion Fluffy_Pillow 37868.8/63800: 59% mana arcane_charge(2), redirected_anima
2:52.653 aoe o arcane_explosion Fluffy_Pillow 34536.5/63800: 54% mana arcane_charge(3), clearcasting, redirected_anima
2:53.959 aoe p arcane_barrage Fluffy_Pillow 36202.9/63800: 57% mana arcane_charge(4), redirected_anima
2:55.265 aoe o arcane_explosion Fluffy_Pillow 40421.4/63800: 63% mana redirected_anima
2:56.572 aoe n shifting_power Fluffy_Pillow 37089.1/63800: 58% mana arcane_charge, clearcasting, redirected_anima
3:00.312 aoe o arcane_explosion Fluffy_Pillow 41212.2/66800: 62% mana arcane_charge, clearcasting, redirected_anima(8)
3:01.620 aoe o arcane_explosion Fluffy_Pillow 42959.7/66800: 64% mana arcane_charge(2), redirected_anima(8)
3:02.926 aoe o arcane_explosion Fluffy_Pillow 39704.5/66800: 59% mana arcane_charge(3), redirected_anima(8)
3:04.233 aoe p arcane_barrage Fluffy_Pillow 36216.8/66371: 55% mana arcane_charge(4), clearcasting, redirected_anima(7)
3:05.538 aoe m arcane_orb Fluffy_Pillow 40604.0/66371: 61% mana clearcasting, redirected_anima(7)
3:06.845 aoe p arcane_barrage Fluffy_Pillow 41838.9/66371: 63% mana arcane_charge(4), clearcasting, redirected_anima(7)
3:08.151 aoe o arcane_explosion Fluffy_Pillow 46227.4/66371: 70% mana clearcasting, redirected_anima(7)
3:09.458 aoe o arcane_explosion Fluffy_Pillow 47962.3/66371: 72% mana arcane_charge, redirected_anima(7)
3:10.764 aoe o arcane_explosion Fluffy_Pillow 44696.0/66371: 67% mana arcane_charge(2), redirected_anima(7)
3:12.071 aoe o arcane_explosion Fluffy_Pillow 41430.9/66371: 62% mana arcane_charge(3), redirected_anima(7)
3:13.376 aoe p arcane_barrage Fluffy_Pillow 38163.2/66371: 57% mana arcane_charge(4), redirected_anima(7)
3:14.682 aoe j touch_of_the_magi Fluffy_Pillow 42551.7/66371: 64% mana redirected_anima(7)
3:15.987 aoe k arcane_power Fluffy_Pillow 41784.0/66371: 63% mana arcane_charge(4), redirected_anima(7)
3:15.987 shared_cds t berserking Fluffy_Pillow 41784.0/66371: 63% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(7)
3:15.987 aoe p arcane_barrage Fluffy_Pillow 41784.0/66371: 63% mana berserking, arcane_charge(4), arcane_power, rune_of_power, redirected_anima(7)
3:17.176 aoe o arcane_explosion Fluffy_Pillow 46017.2/66371: 69% mana berserking, arcane_power, rune_of_power, redirected_anima(7)
3:18.363 aoe o arcane_explosion Fluffy_Pillow 45092.8/66371: 68% mana berserking, arcane_charge, arcane_power, rune_of_power, redirected_anima(7)
3:19.554 aoe o arcane_explosion Fluffy_Pillow 44173.8/66371: 67% mana berserking, arcane_charge(2), arcane_power, rune_of_power, redirected_anima(7)
3:20.741 aoe o arcane_explosion Fluffy_Pillow 43249.4/66371: 65% mana berserking, arcane_charge(3), arcane_power, rune_of_power, redirected_anima(7)
3:21.929 aoe p arcane_barrage Fluffy_Pillow 42326.4/66371: 64% mana berserking, arcane_charge(4), arcane_power, rune_of_power, redirected_anima(7)
3:23.116 aoe o arcane_explosion Fluffy_Pillow 46556.9/66371: 70% mana berserking, arcane_power, rune_of_power, redirected_anima(7)
3:24.303 aoe o arcane_explosion Fluffy_Pillow 45632.6/66371: 69% mana berserking, arcane_charge, arcane_power, rune_of_power, redirected_anima(7)
3:25.493 aoe o arcane_explosion Fluffy_Pillow 44712.2/66371: 67% mana berserking, arcane_charge(2), arcane_power, rune_of_power, redirected_anima(7)
3:26.683 aoe o arcane_explosion Fluffy_Pillow 42095.2/63800: 66% mana berserking, arcane_charge(3), arcane_power, rune_of_power, redirected_anima
3:27.873 aoe p arcane_barrage Fluffy_Pillow 40837.5/63371: 64% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:29.061 aoe m arcane_orb Fluffy_Pillow 44878.1/63371: 71% mana arcane_power, rune_of_power
3:30.368 aoe p arcane_barrage Fluffy_Pillow 46284.6/63371: 73% mana arcane_charge(4), arcane_power, rune_of_power
3:31.772 aoe o arcane_explosion Fluffy_Pillow 50598.9/63371: 80% mana
3:33.081 aoe o arcane_explosion Fluffy_Pillow 47258.0/63371: 75% mana arcane_charge, clearcasting
3:34.389 aoe o arcane_explosion Fluffy_Pillow 48915.8/63371: 77% mana arcane_charge(2)
3:35.695 aoe o arcane_explosion Fluffy_Pillow 45571.1/63371: 72% mana arcane_charge(3)
3:37.003 aoe l rune_of_power Fluffy_Pillow 42228.8/63371: 67% mana arcane_charge(4), clearcasting
3:38.311 aoe p arcane_barrage Fluffy_Pillow 43886.6/63371: 69% mana arcane_charge(4), clearcasting, rune_of_power
3:39.617 aoe o arcane_explosion Fluffy_Pillow 48076.8/63371: 76% mana clearcasting, rune_of_power
3:40.924 aoe o arcane_explosion Fluffy_Pillow 49733.3/63371: 78% mana arcane_charge, rune_of_power
3:42.230 aoe o arcane_explosion Fluffy_Pillow 46388.6/63371: 73% mana arcane_charge(2), rune_of_power
3:43.536 aoe o arcane_explosion Fluffy_Pillow 43043.8/63371: 68% mana arcane_charge(3), rune_of_power
3:44.843 aoe p arcane_barrage Fluffy_Pillow 39700.3/63371: 63% mana arcane_charge(4), clearcasting, rune_of_power
3:46.148 aoe o arcane_explosion Fluffy_Pillow 43889.2/63371: 69% mana clearcasting, rune_of_power
3:47.455 aoe o arcane_explosion Fluffy_Pillow 45545.7/63371: 72% mana arcane_charge, rune_of_power
3:48.760 aoe o arcane_explosion Fluffy_Pillow 42199.7/63371: 67% mana arcane_charge(2), rune_of_power
3:50.066 aoe o arcane_explosion Fluffy_Pillow 38855.0/63371: 61% mana arcane_charge(3), rune_of_power
3:51.372 aoe p arcane_barrage Fluffy_Pillow 35510.2/63371: 56% mana arcane_charge(4), rune_of_power
3:52.678 aoe m arcane_orb Fluffy_Pillow 39700.4/63371: 63% mana rune_of_power
3:53.983 aoe n shifting_power Fluffy_Pillow 40854.4/63371: 64% mana arcane_charge(4)
3:57.728 aoe p arcane_barrage Fluffy_Pillow 44849.8/65943: 68% mana arcane_charge(4), redirected_anima(6)
3:59.034 aoe o arcane_explosion Fluffy_Pillow 49209.9/65943: 75% mana redirected_anima(6)
4:00.340 aoe o arcane_explosion Fluffy_Pillow 45932.4/65943: 70% mana arcane_charge, redirected_anima(6)
4:01.647 aoe o arcane_explosion Fluffy_Pillow 42656.1/65943: 65% mana arcane_charge(2), redirected_anima(6)
4:02.954 aoe o arcane_explosion Fluffy_Pillow 39379.8/65943: 60% mana arcane_charge(3), redirected_anima(6)
4:04.258 aoe p arcane_barrage Fluffy_Pillow 36099.6/65943: 55% mana arcane_charge(4), redirected_anima(6)
4:05.565 aoe m arcane_orb Fluffy_Pillow 40461.1/65943: 61% mana redirected_anima(6)
4:06.871 aoe p arcane_barrage Fluffy_Pillow 41683.5/65943: 63% mana arcane_charge(4), redirected_anima(6)
4:08.176 aoe o arcane_explosion Fluffy_Pillow 46042.3/65943: 70% mana redirected_anima(6)
4:09.484 aoe o arcane_explosion Fluffy_Pillow 42767.4/65943: 65% mana arcane_charge, redirected_anima(6)
4:10.789 aoe j touch_of_the_magi Fluffy_Pillow 39745.2/66371: 60% mana arcane_charge(2), redirected_anima(7)
4:12.096 aoe l rune_of_power Fluffy_Pillow 38980.1/66371: 59% mana arcane_charge(4), redirected_anima(7)
4:13.403 aoe p arcane_barrage Fluffy_Pillow 40715.1/66371: 61% mana arcane_charge(4), rune_of_power, redirected_anima(7)
4:14.711 aoe o arcane_explosion Fluffy_Pillow 45106.2/66371: 68% mana rune_of_power, redirected_anima(7)
4:16.017 aoe o arcane_explosion Fluffy_Pillow 41839.8/66371: 63% mana arcane_charge, rune_of_power, redirected_anima(7)
4:17.325 aoe o arcane_explosion Fluffy_Pillow 38576.1/66371: 58% mana arcane_charge(2), rune_of_power, redirected_anima(7)
4:18.631 aoe o arcane_explosion Fluffy_Pillow 35309.7/66371: 53% mana arcane_charge(3), rune_of_power, redirected_anima(7)
4:19.939 aoe p arcane_barrage Fluffy_Pillow 32046.0/66371: 48% mana arcane_charge(4), rune_of_power, redirected_anima(7)
4:21.244 aoe o arcane_explosion Fluffy_Pillow 36668.4/66800: 55% mana rune_of_power, redirected_anima(8)
4:22.552 shared_cds r use_mana_gem NightFae_Niya 33415.9/66800: 50% mana arcane_charge, rune_of_power, redirected_anima(8)
4:22.606 aoe o arcane_explosion Fluffy_Pillow 40168.0/66800: 60% mana arcane_charge, rune_of_power, redirected_anima(8)
4:23.912 aoe o arcane_explosion Fluffy_Pillow 36912.8/66800: 55% mana arcane_charge(2), rune_of_power, redirected_anima(8)
4:25.217 aoe o arcane_explosion Fluffy_Pillow 32360.7/64229: 50% mana arcane_charge(3), rune_of_power, redirected_anima(2)
4:26.524 aoe p arcane_barrage Fluffy_Pillow 29039.7/64229: 45% mana arcane_charge(4), rune_of_power, redirected_anima(2)
4:27.830 aoe m arcane_orb Fluffy_Pillow 33286.5/64229: 52% mana rune_of_power, redirected_anima(2)
4:29.137 aoe p arcane_barrage Fluffy_Pillow 34465.4/64229: 54% mana arcane_charge(4), redirected_anima(2)
4:30.443 aoe o arcane_explosion Fluffy_Pillow 38712.2/64229: 60% mana redirected_anima(2)
4:31.749 aoe o arcane_explosion Fluffy_Pillow 35389.8/64229: 55% mana arcane_charge, clearcasting, redirected_anima(2)
4:33.055 aoe o arcane_explosion Fluffy_Pillow 37067.5/64229: 58% mana arcane_charge(2), redirected_anima(2)
4:34.362 aoe o arcane_explosion Fluffy_Pillow 33746.4/64229: 53% mana arcane_charge(3), redirected_anima(2)
4:35.668 aoe p arcane_barrage Fluffy_Pillow 30424.1/64229: 47% mana arcane_charge(4), clearcasting, redirected_anima(2)
4:36.973 aoe o arcane_explosion Fluffy_Pillow 34669.6/64229: 54% mana clearcasting, redirected_anima(2)
4:38.280 aoe o arcane_explosion Fluffy_Pillow 36348.5/64229: 57% mana arcane_charge, redirected_anima(2)
4:39.587 aoe n shifting_power Fluffy_Pillow 32807.1/63800: 51% mana arcane_charge(2), clearcasting, redirected_anima
4:43.311 aoe o arcane_explosion Fluffy_Pillow 36471.9/66371: 55% mana arcane_charge(2), clearcasting, redirected_anima(7)
4:44.617 aoe o arcane_explosion Fluffy_Pillow 38205.6/66371: 58% mana arcane_charge(3), redirected_anima(7)
4:45.922 aoe p arcane_barrage Fluffy_Pillow 34937.9/66371: 53% mana arcane_charge(4), redirected_anima(7)
4:47.229 aoe m arcane_orb Fluffy_Pillow 39327.7/66371: 59% mana redirected_anima(7)
4:48.535 aoe p arcane_barrage Fluffy_Pillow 40561.3/66371: 61% mana arcane_charge(4), redirected_anima(7)
4:49.841 aoe o arcane_explosion Fluffy_Pillow 44949.8/66371: 68% mana redirected_anima(7)
4:51.147 aoe j touch_of_the_magi Fluffy_Pillow 41414.2/65943: 63% mana arcane_charge, redirected_anima(6)
4:52.455 aoe k arcane_power Fluffy_Pillow 40639.3/65943: 62% mana arcane_charge(4), redirected_anima(6)
4:52.455 aoe p arcane_barrage Fluffy_Pillow 40639.3/65943: 62% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(6)
4:53.762 aoe o arcane_explosion Fluffy_Pillow 45000.8/65943: 68% mana arcane_power, rune_of_power, redirected_anima(6)
4:55.068 aoe o arcane_explosion Fluffy_Pillow 44223.2/65943: 67% mana arcane_charge, arcane_power, rune_of_power, redirected_anima(6)
4:56.375 aoe o arcane_explosion Fluffy_Pillow 43446.9/65943: 66% mana arcane_charge(2), arcane_power, rune_of_power, redirected_anima(6)
4:57.681 aoe o arcane_explosion Fluffy_Pillow 42669.4/65943: 65% mana arcane_charge(3), arcane_power, rune_of_power, redirected_anima(6)
4:58.988 aoe p arcane_barrage Fluffy_Pillow 41893.1/65943: 64% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(6)
5:00.294 aoe o arcane_explosion Fluffy_Pillow 46253.2/65943: 70% mana arcane_power, rune_of_power, redirected_anima(6)
5:01.600 shared_cds s potion Fluffy_Pillow 45475.7/65943: 69% mana arcane_charge, arcane_power, rune_of_power, redirected_anima(6)
5:01.600 aoe o arcane_explosion Fluffy_Pillow 45475.7/65943: 69% mana arcane_charge, arcane_power, rune_of_power, redirected_anima(6), potion_of_deathly_fixation
5:02.906 aoe o arcane_explosion Fluffy_Pillow 44698.1/65943: 68% mana arcane_charge(2), arcane_power, rune_of_power, redirected_anima(6), potion_of_deathly_fixation
5:04.212 aoe o arcane_explosion Fluffy_Pillow 44206.0/66371: 67% mana arcane_charge(3), arcane_power, rune_of_power, redirected_anima(7), potion_of_deathly_fixation
5:05.518 aoe p arcane_barrage Fluffy_Pillow 43439.6/66371: 65% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(7), potion_of_deathly_fixation
5:06.824 aoe o arcane_explosion Fluffy_Pillow 47828.1/66371: 72% mana arcane_power, rune_of_power, redirected_anima(7), potion_of_deathly_fixation
5:08.131 aoe o arcane_explosion Fluffy_Pillow 47063.0/66371: 71% mana arcane_charge, redirected_anima(7), potion_of_deathly_fixation
5:09.437 aoe o arcane_explosion Fluffy_Pillow 43796.6/66371: 66% mana arcane_charge(2), redirected_anima(7), potion_of_deathly_fixation
5:10.742 aoe o arcane_explosion Fluffy_Pillow 38958.7/63800: 61% mana arcane_charge(3), redirected_anima, potion_of_deathly_fixation
5:12.051 aoe l rune_of_power Fluffy_Pillow 35868.3/64229: 56% mana arcane_charge(4), clearcasting, redirected_anima(2), potion_of_deathly_fixation
5:13.358 aoe p arcane_barrage Fluffy_Pillow 37547.3/64229: 58% mana arcane_charge(4), clearcasting, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:14.665 aoe m arcane_orb Fluffy_Pillow 41795.4/64229: 65% mana clearcasting, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:15.972 aoe p arcane_barrage Fluffy_Pillow 42974.3/64229: 67% mana arcane_charge(4), clearcasting, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:17.280 aoe o arcane_explosion Fluffy_Pillow 47223.7/64229: 74% mana clearcasting, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:18.587 aoe o arcane_explosion Fluffy_Pillow 48902.6/64229: 76% mana arcane_charge, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:19.894 aoe o arcane_explosion Fluffy_Pillow 45581.5/64229: 71% mana arcane_charge(2), rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:21.198 aoe o arcane_explosion Fluffy_Pillow 42256.6/64229: 66% mana arcane_charge(3), rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:22.504 aoe p arcane_barrage Fluffy_Pillow 38934.3/64229: 61% mana arcane_charge(4), clearcasting, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:23.810 aoe o arcane_explosion Fluffy_Pillow 43181.0/64229: 67% mana clearcasting, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:25.117 aoe o arcane_explosion Fluffy_Pillow 44860.0/64229: 70% mana arcane_charge, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:26.424 aoe o arcane_explosion Fluffy_Pillow 41538.9/64229: 65% mana arcane_charge(2), rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:27.728 aoe o arcane_explosion Fluffy_Pillow 38214.0/64229: 59% mana arcane_charge(3), clearcasting, rune_of_power, redirected_anima(2)
5:29.035 aoe n shifting_power Fluffy_Pillow 39892.9/64229: 62% mana arcane_charge(4), redirected_anima(2)
5:32.787 aoe p arcane_barrage Fluffy_Pillow 43902.7/66800: 66% mana arcane_charge(4), redirected_anima(8)
5:34.091 aoe m arcane_orb Fluffy_Pillow 48006.8/66371: 72% mana redirected_anima(7)
5:35.396 aoe p arcane_barrage Fluffy_Pillow 49239.1/66371: 74% mana arcane_charge(4), redirected_anima(7)
5:36.702 aoe o arcane_explosion Fluffy_Pillow 53627.6/66371: 81% mana redirected_anima(7)
5:38.009 aoe o arcane_explosion Fluffy_Pillow 50362.5/66371: 76% mana arcane_charge, redirected_anima(7)
5:39.317 aoe o arcane_explosion Fluffy_Pillow 47098.8/66371: 71% mana arcane_charge(2), redirected_anima(7)
5:40.623 aoe o arcane_explosion Fluffy_Pillow 43832.4/66371: 66% mana arcane_charge(3), redirected_anima(7)
5:41.930 aoe p arcane_barrage Fluffy_Pillow 40305.4/65943: 61% mana arcane_charge(4), clearcasting, redirected_anima(6)
5:43.237 aoe o arcane_explosion Fluffy_Pillow 44666.9/65943: 68% mana clearcasting, redirected_anima(6)
5:44.544 aoe o arcane_explosion Fluffy_Pillow 46390.6/65943: 70% mana arcane_charge, redirected_anima(6)
5:45.851 aoe j touch_of_the_magi Fluffy_Pillow 43114.4/65943: 65% mana arcane_charge(2), redirected_anima(6)
5:47.157 aoe l rune_of_power Fluffy_Pillow 42336.8/65943: 64% mana arcane_charge(4), redirected_anima(6)
5:48.464 aoe p arcane_barrage Fluffy_Pillow 44060.6/65943: 67% mana arcane_charge(4), rune_of_power, redirected_anima(6)
5:49.770 aoe o arcane_explosion Fluffy_Pillow 48420.7/65943: 73% mana rune_of_power, redirected_anima(6)
5:51.077 aoe o arcane_explosion Fluffy_Pillow 45144.4/65943: 68% mana arcane_charge, rune_of_power, redirected_anima(6)
5:52.383 aoe o arcane_explosion Fluffy_Pillow 41866.9/65943: 63% mana arcane_charge(2), clearcasting, rune_of_power, redirected_anima(6)
5:53.690 aoe o arcane_explosion Fluffy_Pillow 43590.6/65943: 66% mana arcane_charge(3), rune_of_power, redirected_anima(6)
5:54.995 aoe p arcane_barrage Fluffy_Pillow 40311.7/65943: 61% mana arcane_charge(4), rune_of_power, redirected_anima(6)
5:56.301 aoe m arcane_orb Fluffy_Pillow 44671.9/65943: 68% mana rune_of_power, redirected_anima(6)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="NightFae_Niya"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=night_fae
soulbind=322721//arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Venthyr_Nadjia : 10140 dps, 4208 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
10140.4 10140.4 12.2 / 0.120% 924.3 / 9.1% 4.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
2093.4 1992.6 Mana 0.00% 50.4 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Nadjia 10140
Arcane Barrage 2852 28.1% 57.8 5.20sec 14850 12148 Direct 173.3 4157 8273 4957 19.4%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.83 173.28 0.00 0.00 1.2224 0.0000 858816.18 858816.18 0.00% 12148.36 12148.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.57% 139.61 104 177 4157.41 2082 10930 4156.39 3728 4521 580303 580303 0.00%
crit 19.43% 33.67 16 59 8273.22 4164 21861 8276.10 6082 10826 278513 278513 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:57.82
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 276 2.7% 43.4 6.45sec 1913 0 Direct 130.3 535 1069 638 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.43 130.29 0.00 0.00 0.0000 0.0000 83093.87 83093.87 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 105.14 70 133 534.76 316 664 534.16 496 561 56216 56216 0.00%
crit 19.30% 25.15 9 43 1068.88 633 1329 1067.73 898 1240 26878 26878 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 5211 51.4% 157.3 1.88sec 9970 8190 Direct 471.9 2785 5572 3324 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 157.31 471.93 0.00 0.00 1.2173 0.0000 1568364.82 1568364.82 0.00% 8190.11 8190.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 380.65 287 465 2784.57 2128 4469 2785.06 2671 2893 1059825 1059825 0.00%
crit 19.34% 91.28 54 134 5571.94 4256 8938 5574.56 5030 6180 508540 508540 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.546000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 54.6%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:157.31
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (852) 0.0% (8.4%) 13.2 23.40sec 19395 15751

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.23 0.00 0.00 0.00 1.2313 0.0000 0.00 0.00 0.00% 15751.39 15751.39

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [n]:13.23
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 852 8.4% 39.7 23.40sec 6473 0 Direct 39.7 5430 10863 6474 19.2%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.65 39.65 0.00 0.00 0.0000 0.0000 256653.08 256653.08 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 32.03 19 45 5430.33 3869 8126 5429.19 4658 6033 173898 173898 0.00%
crit 19.22% 7.62 1 18 10863.22 7739 16251 10872.37 7739 16251 82755 82755 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (68) 0.0% (0.7%) 14.7 1.77sec 1383 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.66 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 68 0.7% 14.7 1.77sec 1383 0 Direct 14.7 1164 2327 1383 18.9%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.66 14.66 0.00 0.00 0.0000 0.0000 20281.20 20281.20 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.10% 11.89 5 19 1163.53 1164 1164 1163.53 1164 1164 13835 13835 0.00%
crit 18.90% 2.77 0 8 2327.06 2327 2327 2186.49 0 2327 6446 6446 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1737 17.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1735.40 1735.40 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.80% 0.83 0 1 1480.68 1481 1481 1225.96 0 1481 1226 1226 0.00%
crit 17.20% 0.17 0 1 2961.35 2961 2961 509.44 0 2961 509 509 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (21) 0.0% (0.2%) 1.0 0.00sec 6095 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 152  / 21 0.2% 90.0 1.29sec 68 52 Direct 90.0 57 113 68 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6095.32 6095.32 0.00% 51.75 51.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 72.67 59 85 56.81 43 60 56.81 56 58 4128 4128 0.00%
crit 19.26% 17.33 5 31 113.49 86 120 113.50 99 120 1967 1967 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Mirrors of Torment 0 (158) 0.0% (1.6%) 2.9 129.66sec 16522 13425

Stats Details: Mirrors Of Torment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.88 0.00 0.00 0.00 1.2310 0.0000 0.00 0.00 0.00% 13424.59 13424.59

Action Details: Mirrors Of Torment

  • id:314793
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • school:shadow
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by {$320035s3=15}%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].

Action Priority List

    aoe
    [j]:2.89
  • if_expr:(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
    Agonizing Backlash 70 0.7% 5.7 52.64sec 3692 0 Direct 5.7 3109 6120 3691 19.4%

Stats Details: Agonizing Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.68 5.68 0.00 0.00 0.0000 0.0000 20966.99 20966.99 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 4.58 0 6 3108.82 1739 3651 3097.29 0 3651 14236 14236 0.00%
crit 19.36% 1.10 0 4 6119.95 3477 7302 4292.28 0 7302 6731 6731 0.00%

Action Details: Agonizing Backlash

  • id:320035
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:320035
  • name:Agonizing Backlash
  • school:shadow
  • tooltip:Movement speed and cast speed slowed by {$s3=15}%.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
    Tormenting Backlash 88 0.9% 2.8 132.09sec 9600 0 Direct 2.8 8084 16137 9603 18.8%

Stats Details: Tormenting Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.77 2.77 0.00 0.00 0.0000 0.0000 26569.48 26569.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.16% 2.25 0 3 8084.15 6126 9188 7954.22 0 9188 18155 18155 0.00%
crit 18.84% 0.52 0 3 16136.68 12251 18377 6958.10 0 18377 8414 8414 0.00%

Action Details: Tormenting Backlash

  • id:317589
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.510000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:317589
  • name:Tormenting Backlash
  • school:shadow
  • tooltip:Rooted and Silenced.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
Touch of the Magi 0 (697) 0.0% (6.9%) 6.2 51.96sec 33927 27809

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.17 0.00 0.00 0.00 1.2201 0.0000 0.00 0.00 0.00% 27808.90 27808.90

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.19
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 697 6.9% 6.2 51.90sec 33927 0 Direct 18.5 11339 0 11339 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.17 18.48 0.00 0.00 0.0000 0.0000 209484.47 209484.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.48 15 21 11338.55 847 45121 11335.96 7970 14400 209484 209484 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:22256.57
  • base_dd_max:22256.57
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Venthyr_Nadjia
Arcane Power 2.9 127.34sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.87
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.9 254.44sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:1.87
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.2 185.69sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.16 0.00 6.90 0.00 4.1808 0.7011 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:1.16
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.0 50.36sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.99 0.00 0.00 0.00 1.2201 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:6.01
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 123.89sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.75
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 58.6 157.8 5.1sec 1.4sec 3.8sec 73.46% 0.00% 1.0 (1.7) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.2s

Stack Uptimes

  • arcane_charge_1:18.78%
  • arcane_charge_2:16.97%
  • arcane_charge_3:16.49%
  • arcane_charge_4:21.23%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 127.3sec 127.3sec 14.7sec 13.99% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.3s / 131.5s
  • trigger_min/max:121.3s / 131.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:13.99%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.9 0.0 254.5sec 254.5sec 11.7sec 7.21% 12.75% 0.0 (0.0) 1.8

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:252.5s / 262.8s
  • trigger_min/max:252.5s / 262.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • berserking_1:7.21%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.46% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.46%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 25.0 0.2 11.7sec 11.6sec 1.9sec 15.90% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.75%
  • clearcasting_2:0.15%
  • clearcasting_3:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Euphoria 3.4 0.0 78.0sec 78.0sec 9.9sec 11.16% 0.00% 0.0 (0.0) 3.3

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_euphoria
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:78.0s / 78.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 10.0s

Stack Uptimes

  • euphoria_1:11.16%

Spelldata

  • id:331937
  • name:Euphoria
  • tooltip:Filled with the thrill of battle, increasing Haste by $w1%.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Evocation 1.2 0.0 177.0sec 177.0sec 4.2sec 1.61% 0.00% 4.6 (4.6) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:104.4s / 265.6s
  • trigger_min/max:104.4s / 265.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.3s

Stack Uptimes

  • evocation_1:1.61%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.41% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.41%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 35.3sec 35.3sec 14.7sec 43.19% 0.00% 0.0 (0.0) 8.5

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.7s / 51.8s
  • trigger_min/max:15.7s / 51.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:43.19%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Thrill Seeker 4.4 145.7 78.0sec 2.0sec 66.6sec 97.07% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_thrill_seeker
  • max_stacks:40
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:2.0s / 2.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 76.0s

Stack Uptimes

  • thrill_seeker_1:2.92%
  • thrill_seeker_3:2.91%
  • thrill_seeker_4:2.89%
  • thrill_seeker_5:2.87%
  • thrill_seeker_6:2.85%
  • thrill_seeker_7:2.83%
  • thrill_seeker_8:2.81%
  • thrill_seeker_9:2.78%
  • thrill_seeker_10:2.76%
  • thrill_seeker_11:2.73%
  • thrill_seeker_12:2.71%
  • thrill_seeker_13:2.69%
  • thrill_seeker_14:2.67%
  • thrill_seeker_15:2.64%
  • thrill_seeker_16:2.62%
  • thrill_seeker_17:2.60%
  • thrill_seeker_18:2.57%
  • thrill_seeker_19:2.55%
  • thrill_seeker_20:2.52%
  • thrill_seeker_21:2.50%
  • thrill_seeker_22:2.49%
  • thrill_seeker_23:2.47%
  • thrill_seeker_24:2.44%
  • thrill_seeker_25:2.43%
  • thrill_seeker_26:2.42%
  • thrill_seeker_27:2.41%
  • thrill_seeker_28:2.40%
  • thrill_seeker_29:2.38%
  • thrill_seeker_30:2.37%
  • thrill_seeker_31:2.36%
  • thrill_seeker_32:2.35%
  • thrill_seeker_33:2.34%
  • thrill_seeker_34:2.32%
  • thrill_seeker_35:2.32%
  • thrill_seeker_36:2.31%
  • thrill_seeker_37:2.30%
  • thrill_seeker_38:2.28%
  • thrill_seeker_39:2.27%

Spelldata

  • id:331939
  • name:Thrill Seeker
  • tooltip:At {$u=40} stacks, you will gain Euphoria.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:40
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.42% 0.77% 6.62% 0.8s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 301.2s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000181.223120.154239.984
Evocation138.87114.390350.972213.219125.268350.972
Rune of Power6.6540.06426.87442.06422.70554.841
Touch of the Magi4.9850.00025.58133.08621.39753.535
Arcane Power5.5591.31011.54016.1339.46025.109
Arcane Barrage2.7580.0008.929160.586126.238193.825
Arcane Orb3.4040.01310.48445.29032.23359.382
Mirrors of Torment24.8300.00071.47672.50666.884138.888

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Nadjia
mana_regen Mana 531.89 369632.20 61.59% 694.94 11496.52 3.02%
Evocation Mana 53.93 55764.01 9.29% 1034.10 0.00 0.00%
Mana Gem Mana 2.75 17450.82 2.91% 6337.14 0.00 0.00%
Arcane Barrage Mana 57.82 139708.03 23.28% 2416.09 6867.32 4.69%
Mirrors of Torment Mana 8.45 17604.89 2.93% 2082.71 3821.98 17.84%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1992.56 2093.38 22188.7 33003.3 140.2 63371.4
Usage Type Count Total Avg RPE APR
Venthyr_Nadjia
arcane_explosion Mana 157.3 602387.9 3829.3 3829.3 2.6
arcane_orb Mana 13.2 5914.2 447.0 446.9 43.4
mirrors_of_torment Mana 2.9 5757.0 2000.0 2000.9 8.3
touch_of_the_magi Mana 6.2 15432.1 2500.0 2499.3 13.6

Statistics & Data Analysis

Fight Length
Venthyr_Nadjia Fight Length
Count 1523
Mean 301.22
Minimum 240.15
Maximum 359.98
Spread ( max - min ) 119.83
Range [ ( max - min ) / 2 * 100% ] 19.89%
DPS
Venthyr_Nadjia Damage Per Second
Count 1523
Mean 10140.40
Minimum 9433.94
Maximum 10952.44
Spread ( max - min ) 1518.50
Range [ ( max - min ) / 2 * 100% ] 7.49%
Standard Deviation 243.0273
5th Percentile 9755.15
95th Percentile 10547.86
( 95th Percentile - 5th Percentile ) 792.72
Mean Distribution
Standard Deviation 6.2274
95.00% Confidence Interval ( 10128.20 - 10152.61 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2207
0.1 Scale Factor Error with Delta=300 505
0.05 Scale Factor Error with Delta=300 2017
0.01 Scale Factor Error with Delta=300 50419
Priority Target DPS
Venthyr_Nadjia Priority Target Damage Per Second
Count 1523
Mean 4207.78
Minimum 3830.38
Maximum 4673.80
Spread ( max - min ) 843.42
Range [ ( max - min ) / 2 * 100% ] 10.02%
Standard Deviation 134.8553
5th Percentile 3995.88
95th Percentile 4426.44
( 95th Percentile - 5th Percentile ) 430.57
Mean Distribution
Standard Deviation 3.4556
95.00% Confidence Interval ( 4201.01 - 4214.56 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3946
0.1 Scale Factor Error with Delta=300 156
0.05 Scale Factor Error with Delta=300 621
0.01 Scale Factor Error with Delta=300 15525
DPS(e)
Venthyr_Nadjia Damage Per Second (Effective)
Count 1523
Mean 10140.40
Minimum 9433.94
Maximum 10952.44
Spread ( max - min ) 1518.50
Range [ ( max - min ) / 2 * 100% ] 7.49%
Damage
Venthyr_Nadjia Damage
Count 1523
Mean 3045965.48
Minimum 2340548.37
Maximum 3631905.25
Spread ( max - min ) 1291356.88
Range [ ( max - min ) / 2 * 100% ] 21.20%
DTPS
Venthyr_Nadjia Damage Taken Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Nadjia Healing Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Nadjia Healing Per Second (Effective)
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Nadjia Heal
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Nadjia Healing Taken Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Nadjia Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_NadjiaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Nadjia Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
j 2.89 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.19 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.87 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 6.01 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
n 13.23 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 157.31 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 57.82 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 1.16 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.75 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 1.87 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjklstpnpoooopoooopoooompoooropnpoooopoooopoooopoooopnpoooopoooopkmpoooopnpoooopoooopoooopnpoooopoooopkmpoooopnpoooolpoooopooooprnpoooopoooopjkmpoooopnpoooopoooopoooqopnpoooopokmpoooopnpoooopoooopoooopnpoooopoooopjkltpoooopnpoooopoooompoooopnpoooopooroopoooopnpoooopoooopkmpoooopnpoooopoooopoooopnpo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Venthyr_Nadjia 63371.4/63371: 100% mana
Pre precombat R food Venthyr_Nadjia 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j mirrors_of_torment Fluffy_Pillow 62371.4/63371: 98% mana
0:01.307 aoe k touch_of_the_magi Fluffy_Pillow 61377.8/63371: 97% mana bloodlust
0:02.314 aoe l arcane_power Fluffy_Pillow 60154.1/63371: 95% mana bloodlust, arcane_charge(4), thrill_seeker
0:02.314 shared_cds s potion Fluffy_Pillow 60154.1/63371: 95% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker
0:02.314 shared_cds t berserking Fluffy_Pillow 60154.1/63371: 95% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker, potion_of_deathly_fixation
0:02.314 aoe p arcane_barrage Fluffy_Pillow 60154.1/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker, potion_of_deathly_fixation
0:03.228 aoe n arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, thrill_seeker, potion_of_deathly_fixation
0:04.142 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(3), potion_of_deathly_fixation
0:05.055 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, thrill_seeker(3), potion_of_deathly_fixation
0:05.968 aoe o arcane_explosion Fluffy_Pillow 62028.6/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, thrill_seeker(3), potion_of_deathly_fixation
0:06.882 aoe o arcane_explosion Fluffy_Pillow 60687.0/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(4), potion_of_deathly_fixation
0:07.796 aoe o arcane_explosion Fluffy_Pillow 59345.5/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(4), potion_of_deathly_fixation
0:08.710 aoe p arcane_barrage Fluffy_Pillow 58003.9/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(5), potion_of_deathly_fixation
0:09.624 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, thrill_seeker(5), potion_of_deathly_fixation
0:10.539 aoe o arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, thrill_seeker(6), potion_of_deathly_fixation
0:11.455 aoe o arcane_explosion Fluffy_Pillow 60692.1/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(6), potion_of_deathly_fixation
0:12.369 aoe o arcane_explosion Fluffy_Pillow 59350.5/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(7), potion_of_deathly_fixation
0:13.283 aoe p arcane_barrage Fluffy_Pillow 58008.9/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(7), potion_of_deathly_fixation
0:14.198 aoe o arcane_explosion Fluffy_Pillow 61703.5/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, thrill_seeker(8), potion_of_deathly_fixation
0:15.112 aoe o arcane_explosion Fluffy_Pillow 62896.8/63371: 99% mana bloodlust, arcane_charge, arcane_power, rune_of_power, thrill_seeker(8), potion_of_deathly_fixation
0:16.119 aoe o arcane_explosion Fluffy_Pillow 61673.1/63371: 97% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(9), potion_of_deathly_fixation
0:17.125 aoe o arcane_explosion Fluffy_Pillow 60448.1/63371: 95% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(9), potion_of_deathly_fixation
0:18.129 aoe m rune_of_power Fluffy_Pillow 59220.6/63371: 93% mana bloodlust, arcane_charge(4), thrill_seeker(10), potion_of_deathly_fixation
0:19.135 aoe p arcane_barrage Fluffy_Pillow 60495.7/63371: 95% mana bloodlust, arcane_charge(4), rune_of_power, thrill_seeker(10), potion_of_deathly_fixation
0:20.142 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, thrill_seeker(11), potion_of_deathly_fixation
0:21.148 aoe o arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge, rune_of_power, thrill_seeker(11), potion_of_deathly_fixation
0:22.154 aoe o arcane_explosion Fluffy_Pillow 55921.5/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power, thrill_seeker(12), potion_of_deathly_fixation
0:23.162 shared_cds r use_mana_gem Venthyr_Nadjia 52199.1/63371: 82% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, thrill_seeker(12), potion_of_deathly_fixation
0:23.162 aoe o arcane_explosion Fluffy_Pillow 58536.2/63371: 92% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, thrill_seeker(12), potion_of_deathly_fixation
0:24.168 aoe p arcane_barrage Fluffy_Pillow 59811.2/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, thrill_seeker(13), potion_of_deathly_fixation
0:25.175 aoe n arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, thrill_seeker(13), potion_of_deathly_fixation
0:26.179 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, thrill_seeker(14), potion_of_deathly_fixation
0:27.186 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, clearcasting, rune_of_power, thrill_seeker(14), potion_of_deathly_fixation
0:28.192 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge, rune_of_power, thrill_seeker(15)
0:29.198 aoe o arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge(2), rune_of_power, thrill_seeker(15)
0:30.206 aoe o arcane_explosion Fluffy_Pillow 55924.0/63371: 88% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, thrill_seeker(16)
0:31.212 aoe p arcane_barrage Fluffy_Pillow 57199.1/63371: 90% mana bloodlust, arcane_charge(4), rune_of_power, thrill_seeker(16)
0:32.219 aoe o arcane_explosion Fluffy_Pillow 61010.2/63371: 96% mana bloodlust, rune_of_power, thrill_seeker(17)
0:33.224 aoe o arcane_explosion Fluffy_Pillow 57284.0/63371: 90% mana bloodlust, arcane_charge, rune_of_power, thrill_seeker(17)
0:34.229 aoe o arcane_explosion Fluffy_Pillow 53557.8/63371: 85% mana bloodlust, arcane_charge(2), thrill_seeker(18)
0:35.235 aoe o arcane_explosion Fluffy_Pillow 49832.8/63371: 79% mana bloodlust, arcane_charge(3), thrill_seeker(18)
0:36.241 aoe p arcane_barrage Fluffy_Pillow 46107.8/63371: 73% mana bloodlust, arcane_charge(4), thrill_seeker(19)
0:37.248 aoe o arcane_explosion Fluffy_Pillow 49919.0/63371: 79% mana bloodlust, thrill_seeker(19)
0:38.255 aoe o arcane_explosion Fluffy_Pillow 46195.3/63371: 73% mana bloodlust, arcane_charge, thrill_seeker(20)
0:39.260 aoe o arcane_explosion Fluffy_Pillow 42469.0/63371: 67% mana bloodlust, arcane_charge(2), thrill_seeker(20)
0:40.267 aoe o arcane_explosion Fluffy_Pillow 38745.3/63371: 61% mana bloodlust, arcane_charge(3), thrill_seeker(21)
0:41.273 aoe p arcane_barrage Fluffy_Pillow 35020.4/63371: 55% mana arcane_charge(4), thrill_seeker(21)
0:42.581 aoe o arcane_explosion Fluffy_Pillow 39213.0/63371: 62% mana thrill_seeker(22)
0:43.888 aoe o arcane_explosion Fluffy_Pillow 35869.6/63371: 57% mana arcane_charge, thrill_seeker(22)
0:45.194 aoe o arcane_explosion Fluffy_Pillow 32524.8/63371: 51% mana arcane_charge(2), thrill_seeker(23)
0:46.498 aoe o arcane_explosion Fluffy_Pillow 29177.5/63371: 46% mana arcane_charge(3), clearcasting, thrill_seeker(24)
0:47.805 aoe p arcane_barrage Fluffy_Pillow 30834.1/63371: 49% mana arcane_charge(4), thrill_seeker(24)
0:49.110 aoe n arcane_orb Fluffy_Pillow 35022.9/63371: 55% mana thrill_seeker(25)
0:50.416 aoe p arcane_barrage Fluffy_Pillow 36178.2/63371: 57% mana arcane_charge(4), thrill_seeker(26)
0:51.723 aoe o arcane_explosion Fluffy_Pillow 40369.6/63371: 64% mana thrill_seeker(26)
0:53.029 aoe o arcane_explosion Fluffy_Pillow 37024.8/63371: 58% mana arcane_charge, thrill_seeker(27)
0:54.337 aoe o arcane_explosion Fluffy_Pillow 33682.6/63371: 53% mana arcane_charge(2), thrill_seeker(28)
0:55.644 aoe o arcane_explosion Fluffy_Pillow 30339.2/63371: 48% mana arcane_charge(3), thrill_seeker(28)
0:56.950 aoe p arcane_barrage Fluffy_Pillow 26994.4/63371: 43% mana arcane_charge(4), thrill_seeker(29)
0:58.257 aoe o arcane_explosion Fluffy_Pillow 31185.8/63371: 49% mana thrill_seeker(30)
0:59.563 aoe o arcane_explosion Fluffy_Pillow 27841.1/63371: 44% mana arcane_charge, thrill_seeker(30)
1:00.868 aoe o arcane_explosion Fluffy_Pillow 24495.1/63371: 39% mana arcane_charge(2), thrill_seeker(31)
1:02.172 aoe o arcane_explosion Fluffy_Pillow 21147.8/63371: 33% mana arcane_charge(3), clearcasting, thrill_seeker(32)
1:03.477 aoe p arcane_barrage Fluffy_Pillow 22801.8/63371: 36% mana arcane_charge(4), thrill_seeker(32)
1:04.783 aoe k touch_of_the_magi Fluffy_Pillow 26991.9/63371: 43% mana thrill_seeker(33)
1:06.091 aoe m rune_of_power Fluffy_Pillow 26149.7/63371: 41% mana arcane_charge(4), thrill_seeker(34)
1:07.399 aoe p arcane_barrage Fluffy_Pillow 27807.5/63371: 44% mana arcane_charge(4), rune_of_power, thrill_seeker(34)
1:08.706 aoe o arcane_explosion Fluffy_Pillow 31998.9/63371: 50% mana rune_of_power, thrill_seeker(35)
1:10.012 aoe o arcane_explosion Fluffy_Pillow 28654.1/63371: 45% mana arcane_charge, rune_of_power, thrill_seeker(36)
1:11.318 aoe o arcane_explosion Fluffy_Pillow 25309.4/63371: 40% mana arcane_charge(2), rune_of_power, thrill_seeker(36)
1:12.624 aoe o arcane_explosion Fluffy_Pillow 21964.7/63371: 35% mana arcane_charge(3), rune_of_power, thrill_seeker(37)
1:13.931 aoe p arcane_barrage Fluffy_Pillow 18621.2/63371: 29% mana arcane_charge(4), rune_of_power, thrill_seeker(37)
1:15.238 aoe n arcane_orb Fluffy_Pillow 22812.6/63371: 36% mana rune_of_power, thrill_seeker(38)
1:16.544 aoe p arcane_barrage Fluffy_Pillow 23967.8/63371: 38% mana arcane_charge(4), rune_of_power, thrill_seeker(39)
1:17.852 aoe o arcane_explosion Fluffy_Pillow 28160.5/63371: 44% mana rune_of_power, thrill_seeker(39)
1:19.159 aoe o arcane_explosion Fluffy_Pillow 24817.0/63371: 39% mana arcane_charge, rune_of_power, euphoria
1:20.248 aoe o arcane_explosion Fluffy_Pillow 21197.3/63371: 33% mana arcane_charge(2), clearcasting, rune_of_power, thrill_seeker, euphoria
1:21.338 aoe o arcane_explosion Fluffy_Pillow 22578.8/63371: 36% mana arcane_charge(3), rune_of_power, thrill_seeker, euphoria
1:22.429 aoe p arcane_barrage Fluffy_Pillow 18961.5/63371: 30% mana arcane_charge(4), thrill_seeker(3), euphoria
1:23.519 aoe o arcane_explosion Fluffy_Pillow 22877.9/63371: 36% mana thrill_seeker(3), euphoria
1:24.608 aoe o arcane_explosion Fluffy_Pillow 19258.1/63371: 30% mana arcane_charge, clearcasting, thrill_seeker(4), euphoria
1:25.697 aoe o arcane_explosion Fluffy_Pillow 20638.3/63371: 33% mana arcane_charge(2), thrill_seeker(4), euphoria
1:26.790 aoe o arcane_explosion Fluffy_Pillow 17023.6/63371: 27% mana arcane_charge(3), thrill_seeker(5), euphoria
1:27.880 aoe p arcane_barrage Fluffy_Pillow 13405.1/63371: 21% mana arcane_charge(4), thrill_seeker(5), euphoria
1:28.970 aoe o arcane_explosion Fluffy_Pillow 17321.5/63371: 27% mana thrill_seeker(6)
1:30.276 aoe o arcane_explosion Fluffy_Pillow 13976.7/63371: 22% mana arcane_charge, thrill_seeker(7)
1:31.583 aoe o arcane_explosion Fluffy_Pillow 10633.3/63371: 17% mana arcane_charge(2), clearcasting, thrill_seeker(7)
1:32.890 aoe o arcane_explosion Fluffy_Pillow 12289.8/63371: 19% mana arcane_charge(3), thrill_seeker(8)
1:34.198 aoe p arcane_barrage Fluffy_Pillow 8947.6/63371: 14% mana arcane_charge(4), clearcasting, thrill_seeker(9)
1:35.504 aoe n arcane_orb Fluffy_Pillow 13137.7/63371: 21% mana clearcasting, thrill_seeker(9)
1:36.810 aoe p arcane_barrage Fluffy_Pillow 14293.0/63371: 23% mana arcane_charge(4), clearcasting, thrill_seeker(10)
1:38.115 aoe o arcane_explosion Fluffy_Pillow 18481.8/63371: 29% mana clearcasting, thrill_seeker(11)
1:39.421 aoe o arcane_explosion Fluffy_Pillow 20137.1/63371: 32% mana arcane_charge, thrill_seeker(11)
1:40.728 aoe o arcane_explosion Fluffy_Pillow 16793.6/63371: 27% mana arcane_charge(2), clearcasting, thrill_seeker(12)
1:42.035 aoe o arcane_explosion Fluffy_Pillow 18450.2/63371: 29% mana arcane_charge(3), thrill_seeker(13)
1:43.342 aoe p arcane_barrage Fluffy_Pillow 15106.7/63371: 24% mana arcane_charge(4), clearcasting, thrill_seeker(13)
1:44.650 aoe o arcane_explosion Fluffy_Pillow 19299.3/63371: 30% mana clearcasting, thrill_seeker(14)
1:45.956 aoe o arcane_explosion Fluffy_Pillow 20954.6/63371: 33% mana arcane_charge, thrill_seeker(14)
1:47.263 aoe o arcane_explosion Fluffy_Pillow 17611.1/63371: 28% mana arcane_charge(2), thrill_seeker(15)
1:48.571 aoe o arcane_explosion Fluffy_Pillow 14268.9/63371: 23% mana arcane_charge(3), thrill_seeker(16)
1:49.878 aoe p arcane_barrage Fluffy_Pillow 10925.5/63371: 17% mana arcane_charge(4), clearcasting, thrill_seeker(16)
1:51.183 aoe k touch_of_the_magi Fluffy_Pillow 15114.3/63371: 24% mana clearcasting, thrill_seeker(17)
1:52.491 aoe m rune_of_power Fluffy_Pillow 14272.1/63371: 23% mana arcane_charge(4), clearcasting, thrill_seeker(18)
1:53.797 aoe p arcane_barrage Fluffy_Pillow 15927.4/63371: 25% mana arcane_charge(4), clearcasting, rune_of_power, thrill_seeker(18)
1:55.106 aoe o arcane_explosion Fluffy_Pillow 20121.3/63371: 32% mana clearcasting, rune_of_power, thrill_seeker(19)
1:56.412 aoe o arcane_explosion Fluffy_Pillow 21776.5/63371: 34% mana arcane_charge, rune_of_power, thrill_seeker(20)
1:57.720 aoe o arcane_explosion Fluffy_Pillow 18434.3/63371: 29% mana arcane_charge(2), rune_of_power, thrill_seeker(20)
1:59.027 aoe o arcane_explosion Fluffy_Pillow 15090.9/63371: 24% mana arcane_charge(3), rune_of_power, thrill_seeker(21)
2:00.333 aoe p arcane_barrage Fluffy_Pillow 11746.1/63371: 19% mana arcane_charge(4), rune_of_power, thrill_seeker(22)
2:01.639 aoe n arcane_orb Fluffy_Pillow 15936.3/63371: 25% mana rune_of_power, thrill_seeker(22)
2:02.948 aoe p arcane_barrage Fluffy_Pillow 17095.3/63371: 27% mana arcane_charge(4), rune_of_power, thrill_seeker(23)
2:04.253 aoe o arcane_explosion Fluffy_Pillow 21284.2/63371: 34% mana rune_of_power, thrill_seeker(24)
2:05.559 aoe o arcane_explosion Fluffy_Pillow 17939.4/63371: 28% mana arcane_charge, rune_of_power, thrill_seeker(24)
2:06.865 aoe o arcane_explosion Fluffy_Pillow 14594.7/63371: 23% mana arcane_charge(2), rune_of_power, thrill_seeker(25)
2:08.171 aoe o arcane_explosion Fluffy_Pillow 11250.0/63371: 18% mana arcane_charge(3), rune_of_power, thrill_seeker(26)
2:09.478 aoe l arcane_power Fluffy_Pillow 7906.5/63371: 12% mana arcane_charge(4), thrill_seeker(26)
2:09.478 aoe p arcane_barrage Fluffy_Pillow 7906.5/63371: 12% mana arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(26)
2:10.784 aoe o arcane_explosion Fluffy_Pillow 12096.6/63371: 19% mana arcane_power, rune_of_power, thrill_seeker(27)
2:12.089 aoe o arcane_explosion Fluffy_Pillow 11250.6/63371: 18% mana arcane_charge, arcane_power, rune_of_power, thrill_seeker(28)
2:13.395 aoe o arcane_explosion Fluffy_Pillow 10405.9/63371: 16% mana arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(28)
2:14.702 aoe o arcane_explosion Fluffy_Pillow 9562.4/63371: 15% mana arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(29)
2:16.008 aoe p arcane_barrage Fluffy_Pillow 8717.7/63371: 14% mana arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(30)
2:17.314 aoe o arcane_explosion Fluffy_Pillow 12907.8/63371: 20% mana arcane_power, rune_of_power, thrill_seeker(30)
2:18.620 aoe o arcane_explosion Fluffy_Pillow 12063.0/63371: 19% mana arcane_charge, arcane_power, rune_of_power, thrill_seeker(31)
2:19.927 aoe o arcane_explosion Fluffy_Pillow 11219.6/63371: 18% mana arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(31)
2:21.233 aoe o arcane_explosion Fluffy_Pillow 10374.8/63371: 16% mana arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(32)
2:22.540 aoe p arcane_barrage Fluffy_Pillow 9531.4/63371: 15% mana arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(33)
2:23.847 shared_cds r use_mana_gem Venthyr_Nadjia 13722.7/63371: 22% mana arcane_power, rune_of_power, thrill_seeker(33)
2:23.847 aoe n arcane_orb Fluffy_Pillow 20059.9/63371: 32% mana arcane_power, rune_of_power, thrill_seeker(33)
2:25.152 aoe p arcane_barrage Fluffy_Pillow 21463.9/63371: 34% mana arcane_charge(4), thrill_seeker(34)
2:26.459 aoe o arcane_explosion Fluffy_Pillow 25655.3/63371: 40% mana thrill_seeker(35)
2:27.766 aoe o arcane_explosion Fluffy_Pillow 22311.8/63371: 35% mana arcane_charge, thrill_seeker(35)
2:29.074 aoe o arcane_explosion Fluffy_Pillow 18969.6/63371: 30% mana arcane_charge(2), thrill_seeker(36)
2:30.381 aoe o arcane_explosion Fluffy_Pillow 15626.1/63371: 25% mana arcane_charge(3), clearcasting, thrill_seeker(37)
2:31.687 aoe p arcane_barrage Fluffy_Pillow 17281.4/63371: 27% mana arcane_charge(4), thrill_seeker(37)
2:32.994 aoe o arcane_explosion Fluffy_Pillow 21472.8/63371: 34% mana thrill_seeker(38)
2:34.301 aoe o arcane_explosion Fluffy_Pillow 18129.3/63371: 29% mana arcane_charge, thrill_seeker(39)
2:35.608 aoe o arcane_explosion Fluffy_Pillow 14785.8/63371: 23% mana arcane_charge(2), thrill_seeker(39)
2:36.913 aoe o arcane_explosion Fluffy_Pillow 11439.8/63371: 18% mana arcane_charge(3), clearcasting, euphoria
2:38.002 aoe p arcane_barrage Fluffy_Pillow 12820.0/63371: 20% mana arcane_charge(4), thrill_seeker, euphoria
2:39.093 aoe j mirrors_of_torment Fluffy_Pillow 16737.7/63371: 26% mana thrill_seeker, euphoria
2:40.183 aoe k touch_of_the_magi Fluffy_Pillow 16119.2/63371: 25% mana thrill_seeker(3), euphoria
2:41.273 aoe m rune_of_power Fluffy_Pillow 15000.7/63371: 24% mana arcane_charge(4), thrill_seeker(3), euphoria
2:42.363 aoe p arcane_barrage Fluffy_Pillow 18917.0/63371: 30% mana arcane_charge(4), rune_of_power, thrill_seeker(4), euphoria
2:43.453 aoe o arcane_explosion Fluffy_Pillow 22833.4/63371: 36% mana rune_of_power, thrill_seeker(4), euphoria
2:44.543 aoe o arcane_explosion Fluffy_Pillow 19214.9/63371: 30% mana arcane_charge, rune_of_power, thrill_seeker(5), euphoria
2:45.632 aoe o arcane_explosion Fluffy_Pillow 15595.1/63371: 25% mana arcane_charge(2), clearcasting, rune_of_power, thrill_seeker(5), euphoria
2:46.721 aoe o arcane_explosion Fluffy_Pillow 16975.3/63371: 27% mana arcane_charge(3), rune_of_power, thrill_seeker(6)
2:48.027 aoe p arcane_barrage Fluffy_Pillow 16165.4/63371: 26% mana arcane_charge(4), rune_of_power, thrill_seeker(7)
2:49.333 aoe n arcane_orb Fluffy_Pillow 20355.6/63371: 32% mana rune_of_power, thrill_seeker(7)
2:50.640 aoe p arcane_barrage Fluffy_Pillow 21512.1/63371: 34% mana arcane_charge(4), rune_of_power, thrill_seeker(8)
2:51.944 aoe o arcane_explosion Fluffy_Pillow 25699.7/63371: 41% mana rune_of_power, thrill_seeker(8)
2:53.252 aoe o arcane_explosion Fluffy_Pillow 22357.5/63371: 35% mana arcane_charge, rune_of_power, thrill_seeker(9)
2:54.558 aoe o arcane_explosion Fluffy_Pillow 21547.6/63371: 34% mana arcane_charge(2), rune_of_power, thrill_seeker(10)
2:55.865 aoe o arcane_explosion Fluffy_Pillow 18204.1/63371: 29% mana arcane_charge(3), rune_of_power, thrill_seeker(10)
2:57.173 aoe p arcane_barrage Fluffy_Pillow 14861.9/63371: 23% mana arcane_charge(4), rune_of_power, thrill_seeker(11)
2:58.479 aoe o arcane_explosion Fluffy_Pillow 19052.0/63371: 30% mana thrill_seeker(12)
2:59.786 aoe o arcane_explosion Fluffy_Pillow 15708.6/63371: 25% mana arcane_charge, thrill_seeker(12)
3:01.092 aoe o arcane_explosion Fluffy_Pillow 12363.8/63371: 20% mana arcane_charge(2), thrill_seeker(13)
3:02.398 aoe o arcane_explosion Fluffy_Pillow 9019.1/63371: 14% mana arcane_charge(3), thrill_seeker(14)
3:03.704 aoe p arcane_barrage Fluffy_Pillow 5674.4/63371: 9% mana arcane_charge(4), thrill_seeker(14)
3:05.012 aoe o arcane_explosion Fluffy_Pillow 9867.0/63371: 16% mana thrill_seeker(15)
3:06.319 aoe o arcane_explosion Fluffy_Pillow 6523.5/63371: 10% mana arcane_charge, clearcasting, thrill_seeker(16)
3:07.626 aoe o arcane_explosion Fluffy_Pillow 8180.1/63371: 13% mana arcane_charge(2), thrill_seeker(16)
3:08.933 aoe q evocation Venthyr_Nadjia 4836.6/63371: 8% mana arcane_charge(3), thrill_seeker(17)
3:13.277 aoe o arcane_explosion Fluffy_Pillow 58681.3/63371: 93% mana arcane_charge(3), thrill_seeker(19)
3:14.585 aoe p arcane_barrage Fluffy_Pillow 55339.1/63371: 87% mana arcane_charge(4), thrill_seeker(20)
3:15.891 aoe n arcane_orb Fluffy_Pillow 59529.2/63371: 94% mana thrill_seeker(20)
3:17.196 aoe p arcane_barrage Fluffy_Pillow 60683.2/63371: 96% mana arcane_charge(4), thrill_seeker(21)
3:18.503 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana thrill_seeker(22)
3:19.809 aoe o arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge, thrill_seeker(22)
3:21.115 aoe o arcane_explosion Fluffy_Pillow 56682.0/63371: 89% mana arcane_charge(2), thrill_seeker(23)
3:22.422 aoe o arcane_explosion Fluffy_Pillow 53338.5/63371: 84% mana arcane_charge(3), thrill_seeker(24)
3:23.728 aoe p arcane_barrage Fluffy_Pillow 49993.7/63371: 79% mana arcane_charge(4), thrill_seeker(24)
3:25.034 aoe o arcane_explosion Fluffy_Pillow 54183.9/63371: 86% mana thrill_seeker(25)
3:26.340 aoe k touch_of_the_magi Fluffy_Pillow 50839.1/63371: 80% mana arcane_charge, clearcasting, thrill_seeker(26)
3:27.648 aoe m rune_of_power Fluffy_Pillow 49996.9/63371: 79% mana arcane_charge(4), clearcasting, thrill_seeker(26)
3:28.954 aoe p arcane_barrage Fluffy_Pillow 51652.2/63371: 82% mana arcane_charge(4), clearcasting, rune_of_power, thrill_seeker(27)
3:30.261 aoe o arcane_explosion Fluffy_Pillow 55843.6/63371: 88% mana clearcasting, rune_of_power, thrill_seeker(28)
3:31.569 aoe o arcane_explosion Fluffy_Pillow 57501.4/63371: 91% mana arcane_charge, rune_of_power, thrill_seeker(28)
3:32.876 aoe o arcane_explosion Fluffy_Pillow 54157.9/63371: 85% mana arcane_charge(2), rune_of_power, thrill_seeker(29)
3:34.183 aoe o arcane_explosion Fluffy_Pillow 50814.4/63371: 80% mana arcane_charge(3), clearcasting, rune_of_power, thrill_seeker(30)
3:35.489 aoe p arcane_barrage Fluffy_Pillow 52469.7/63371: 83% mana arcane_charge(4), rune_of_power, thrill_seeker(30)
3:36.796 aoe n arcane_orb Fluffy_Pillow 56661.1/63371: 89% mana rune_of_power, thrill_seeker(31)
3:38.101 aoe p arcane_barrage Fluffy_Pillow 57815.1/63371: 91% mana arcane_charge(4), rune_of_power, thrill_seeker(32)
3:39.409 aoe o arcane_explosion Fluffy_Pillow 62007.7/63371: 98% mana rune_of_power, thrill_seeker(32)
3:40.714 aoe o arcane_explosion Fluffy_Pillow 58661.7/63371: 93% mana arcane_charge, rune_of_power, thrill_seeker(33)
3:42.020 aoe o arcane_explosion Fluffy_Pillow 55317.0/63371: 87% mana arcane_charge(2), rune_of_power, thrill_seeker(34)
3:43.327 aoe o arcane_explosion Fluffy_Pillow 51973.5/63371: 82% mana arcane_charge(3), clearcasting, rune_of_power, thrill_seeker(34)
3:44.633 aoe p arcane_barrage Fluffy_Pillow 53628.8/63371: 85% mana arcane_charge(4), thrill_seeker(35)
3:45.940 aoe o arcane_explosion Fluffy_Pillow 57820.2/63371: 91% mana thrill_seeker(35)
3:47.246 aoe o arcane_explosion Fluffy_Pillow 54475.4/63371: 86% mana arcane_charge, thrill_seeker(36)
3:48.551 aoe o arcane_explosion Fluffy_Pillow 51129.4/63371: 81% mana arcane_charge(2), thrill_seeker(37)
3:49.857 aoe o arcane_explosion Fluffy_Pillow 47784.7/63371: 75% mana arcane_charge(3), thrill_seeker(37)
3:51.162 aoe p arcane_barrage Fluffy_Pillow 44438.7/63371: 70% mana arcane_charge(4), thrill_seeker(38)
3:52.467 aoe o arcane_explosion Fluffy_Pillow 48627.5/63371: 77% mana thrill_seeker(39)
3:53.774 aoe o arcane_explosion Fluffy_Pillow 45284.0/63371: 71% mana arcane_charge, thrill_seeker(39)
3:55.081 aoe o arcane_explosion Fluffy_Pillow 41940.6/63371: 66% mana arcane_charge(2), clearcasting, euphoria
3:56.171 aoe o arcane_explosion Fluffy_Pillow 43322.1/63371: 68% mana arcane_charge(3), thrill_seeker, euphoria
3:57.261 aoe p arcane_barrage Fluffy_Pillow 39703.6/63371: 63% mana arcane_charge(4), clearcasting, thrill_seeker, euphoria
3:58.349 aoe n arcane_orb Fluffy_Pillow 43617.4/63371: 69% mana clearcasting, thrill_seeker(3), euphoria
3:59.440 aoe p arcane_barrage Fluffy_Pillow 44500.2/63371: 70% mana arcane_charge(4), clearcasting, thrill_seeker(3), euphoria
4:00.529 aoe o arcane_explosion Fluffy_Pillow 48415.2/63371: 76% mana clearcasting, thrill_seeker(4), euphoria
4:01.614 aoe o arcane_explosion Fluffy_Pillow 49790.4/63371: 79% mana arcane_charge, thrill_seeker(4), euphoria
4:02.704 aoe o arcane_explosion Fluffy_Pillow 46171.9/63371: 73% mana arcane_charge(2), thrill_seeker(5), euphoria
4:03.793 aoe o arcane_explosion Fluffy_Pillow 42552.1/63371: 67% mana arcane_charge(3), thrill_seeker(5), euphoria
4:04.883 aoe p arcane_barrage Fluffy_Pillow 38933.6/63371: 61% mana arcane_charge(4), clearcasting, thrill_seeker(6)
4:06.188 aoe o arcane_explosion Fluffy_Pillow 43122.5/63371: 68% mana clearcasting, thrill_seeker(7)
4:07.494 aoe o arcane_explosion Fluffy_Pillow 44777.7/63371: 71% mana arcane_charge, thrill_seeker(7)
4:08.803 aoe o arcane_explosion Fluffy_Pillow 41436.8/63371: 65% mana arcane_charge(2), clearcasting, thrill_seeker(8)
4:10.112 aoe o arcane_explosion Fluffy_Pillow 43095.9/63371: 68% mana arcane_charge(3), thrill_seeker(9)
4:11.418 aoe p arcane_barrage Fluffy_Pillow 39751.1/63371: 63% mana arcane_charge(4), thrill_seeker(9)
4:12.724 aoe j mirrors_of_torment Fluffy_Pillow 43941.2/63371: 69% mana thrill_seeker(10)
4:14.030 aoe k touch_of_the_magi Fluffy_Pillow 43596.5/63371: 69% mana thrill_seeker(11)
4:15.336 aoe l arcane_power Fluffy_Pillow 42751.8/63371: 67% mana arcane_charge(4), thrill_seeker(11)
4:15.336 shared_cds t berserking Fluffy_Pillow 42751.8/63371: 67% mana arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(11)
4:15.336 aoe p arcane_barrage Fluffy_Pillow 42751.8/63371: 67% mana berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(11)
4:16.525 aoe o arcane_explosion Fluffy_Pillow 49328.5/63371: 78% mana berserking, arcane_power, rune_of_power, thrill_seeker(12)
4:17.713 aoe o arcane_explosion Fluffy_Pillow 48334.2/63371: 76% mana berserking, arcane_charge, arcane_power, rune_of_power, thrill_seeker(12)
4:18.901 aoe o arcane_explosion Fluffy_Pillow 47339.9/63371: 75% mana berserking, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(13)
4:20.088 aoe o arcane_explosion Fluffy_Pillow 46344.3/63371: 73% mana berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power, thrill_seeker(14)
4:21.275 aoe p arcane_barrage Fluffy_Pillow 47848.7/63371: 76% mana berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(14)
4:22.464 aoe n arcane_orb Fluffy_Pillow 54425.4/63371: 86% mana berserking, arcane_power, rune_of_power, thrill_seeker(15)
4:23.654 aoe p arcane_barrage Fluffy_Pillow 55683.7/63371: 88% mana berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(15)
4:24.842 aoe o arcane_explosion Fluffy_Pillow 59724.2/63371: 94% mana berserking, arcane_power, rune_of_power, thrill_seeker(16)
4:26.030 aoe o arcane_explosion Fluffy_Pillow 58729.9/63371: 93% mana berserking, arcane_charge, arcane_power, clearcasting, rune_of_power, thrill_seeker(17)
4:27.218 aoe o arcane_explosion Fluffy_Pillow 60235.6/63371: 95% mana berserking, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(17)
4:28.406 aoe o arcane_explosion Fluffy_Pillow 61776.2/63371: 97% mana arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(18)
4:29.712 aoe p arcane_barrage Fluffy_Pillow 60931.5/63371: 96% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, thrill_seeker(18)
4:31.018 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana clearcasting, thrill_seeker(19)
4:32.323 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge, thrill_seeker(20)
4:33.629 aoe o arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge(2), clearcasting, thrill_seeker(20)
4:34.936 aoe o arcane_explosion Fluffy_Pillow 61683.2/63371: 97% mana arcane_charge(3), thrill_seeker(21)
4:36.243 aoe m rune_of_power Fluffy_Pillow 58339.7/63371: 92% mana arcane_charge(4), clearcasting, thrill_seeker(22)
4:37.548 aoe p arcane_barrage Fluffy_Pillow 59993.7/63371: 95% mana arcane_charge(4), clearcasting, rune_of_power, thrill_seeker(22)
4:38.854 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana clearcasting, rune_of_power, thrill_seeker(23)
4:40.159 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge, rune_of_power, thrill_seeker(24)
4:41.467 aoe o arcane_explosion Fluffy_Pillow 60029.2/63371: 95% mana arcane_charge(2), rune_of_power, thrill_seeker(24)
4:42.775 aoe o arcane_explosion Fluffy_Pillow 56687.0/63371: 89% mana arcane_charge(3), clearcasting, rune_of_power, thrill_seeker(25)
4:44.081 aoe p arcane_barrage Fluffy_Pillow 58342.3/63371: 92% mana arcane_charge(4), rune_of_power, thrill_seeker(26)
4:45.386 aoe n arcane_orb Fluffy_Pillow 62531.1/63371: 99% mana rune_of_power, thrill_seeker(26)
4:46.694 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(4), rune_of_power, thrill_seeker(27)
4:47.999 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power, thrill_seeker(27)
4:49.306 aoe o arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge, rune_of_power, thrill_seeker(28)
4:50.613 aoe o arcane_explosion Fluffy_Pillow 56684.5/63371: 89% mana arcane_charge(2), clearcasting, rune_of_power, thrill_seeker(29)
4:51.922 aoe o arcane_explosion Fluffy_Pillow 58343.6/63371: 92% mana arcane_charge(3), rune_of_power, thrill_seeker(29)
4:53.228 aoe p arcane_barrage Fluffy_Pillow 54998.8/63371: 87% mana arcane_charge(4), thrill_seeker(30)
4:54.535 aoe o arcane_explosion Fluffy_Pillow 59190.2/63371: 93% mana thrill_seeker(31)
4:55.842 aoe o arcane_explosion Fluffy_Pillow 55846.7/63371: 88% mana arcane_charge, thrill_seeker(31)
4:57.150 shared_cds r use_mana_gem Venthyr_Nadjia 52504.5/63371: 83% mana arcane_charge(2), thrill_seeker(32)
4:57.150 aoe o arcane_explosion Fluffy_Pillow 58841.7/63371: 93% mana arcane_charge(2), thrill_seeker(32)
4:58.458 aoe o arcane_explosion Fluffy_Pillow 55499.5/63371: 88% mana arcane_charge(3), clearcasting, thrill_seeker(33)
4:59.766 aoe p arcane_barrage Fluffy_Pillow 57157.3/63371: 90% mana arcane_charge(4), thrill_seeker(33)
5:01.073 aoe o arcane_explosion Fluffy_Pillow 61348.6/63371: 97% mana thrill_seeker(34)
5:02.378 aoe o arcane_explosion Fluffy_Pillow 58002.6/63371: 92% mana arcane_charge, thrill_seeker(35)
5:03.683 aoe o arcane_explosion Fluffy_Pillow 54656.6/63371: 86% mana arcane_charge(2), thrill_seeker(35)
5:04.990 aoe o arcane_explosion Fluffy_Pillow 51313.2/63371: 81% mana arcane_charge(3), thrill_seeker(36)
5:06.297 aoe p arcane_barrage Fluffy_Pillow 47969.7/63371: 76% mana arcane_charge(4), thrill_seeker(37)
5:07.603 aoe n arcane_orb Fluffy_Pillow 52159.8/63371: 82% mana thrill_seeker(37)
5:08.909 aoe p arcane_barrage Fluffy_Pillow 53315.1/63371: 84% mana arcane_charge(4), thrill_seeker(38)
5:10.217 aoe o arcane_explosion Fluffy_Pillow 57507.7/63371: 91% mana thrill_seeker(39)
5:11.525 aoe o arcane_explosion Fluffy_Pillow 54165.5/63371: 85% mana arcane_charge, thrill_seeker(39)
5:12.833 aoe o arcane_explosion Fluffy_Pillow 50823.3/63371: 80% mana arcane_charge(2), clearcasting, euphoria
5:13.921 aoe o arcane_explosion Fluffy_Pillow 52202.3/63371: 82% mana arcane_charge(3), euphoria
5:15.010 aoe p arcane_barrage Fluffy_Pillow 48582.5/63371: 77% mana arcane_charge(4), thrill_seeker, euphoria
5:16.099 aoe o arcane_explosion Fluffy_Pillow 52497.6/63371: 83% mana thrill_seeker(3), euphoria
5:17.188 aoe o arcane_explosion Fluffy_Pillow 48877.8/63371: 77% mana arcane_charge, thrill_seeker(3), euphoria
5:18.277 aoe o arcane_explosion Fluffy_Pillow 45258.1/63371: 71% mana arcane_charge(2), clearcasting, thrill_seeker(4), euphoria
5:19.367 aoe o arcane_explosion Fluffy_Pillow 46639.6/63371: 74% mana arcane_charge(3), thrill_seeker(4), euphoria
5:20.458 aoe p arcane_barrage Fluffy_Pillow 43022.3/63371: 68% mana arcane_charge(4), thrill_seeker(5), euphoria
5:21.547 aoe k touch_of_the_magi Fluffy_Pillow 46937.4/63371: 74% mana thrill_seeker(5), euphoria
5:22.635 aoe m rune_of_power Fluffy_Pillow 45816.4/63371: 72% mana arcane_charge(4), thrill_seeker(6)
5:23.942 aoe p arcane_barrage Fluffy_Pillow 47472.9/63371: 75% mana arcane_charge(4), rune_of_power, thrill_seeker(6)
5:25.249 aoe o arcane_explosion Fluffy_Pillow 51664.3/63371: 82% mana rune_of_power, thrill_seeker(7)
5:26.555 aoe o arcane_explosion Fluffy_Pillow 48319.5/63371: 76% mana arcane_charge, rune_of_power, thrill_seeker(8)
5:27.863 aoe o arcane_explosion Fluffy_Pillow 44977.3/63371: 71% mana arcane_charge(2), rune_of_power, thrill_seeker(8)
5:29.170 aoe o arcane_explosion Fluffy_Pillow 41633.9/63371: 66% mana arcane_charge(3), clearcasting, rune_of_power, thrill_seeker(9)
5:30.476 aoe p arcane_barrage Fluffy_Pillow 43289.1/63371: 68% mana arcane_charge(4), rune_of_power, thrill_seeker(10)
5:31.784 aoe n arcane_orb Fluffy_Pillow 47481.8/63371: 75% mana rune_of_power, thrill_seeker(10)
5:33.089 aoe p arcane_barrage Fluffy_Pillow 48635.8/63371: 77% mana arcane_charge(4), rune_of_power, thrill_seeker(11)
5:34.395 aoe o arcane_explosion Fluffy_Pillow 52825.9/63371: 83% mana rune_of_power, thrill_seeker(12)
5:35.702 aoe o arcane_explosion Fluffy_Pillow 49482.4/63371: 78% mana arcane_charge, rune_of_power, thrill_seeker(12)
5:37.009 aoe o arcane_explosion Fluffy_Pillow 46139.0/63371: 73% mana arcane_charge(2), clearcasting, rune_of_power, thrill_seeker(13)
5:38.315 aoe o arcane_explosion Fluffy_Pillow 47794.2/63371: 75% mana arcane_charge(3), rune_of_power, thrill_seeker(14)
5:39.623 aoe p arcane_barrage Fluffy_Pillow 44452.0/63371: 70% mana arcane_charge(4), thrill_seeker(14)
5:40.931 aoe o arcane_explosion Fluffy_Pillow 48644.7/63371: 77% mana thrill_seeker(15)
5:42.237 aoe o arcane_explosion Fluffy_Pillow 45299.9/63371: 71% mana arcane_charge, thrill_seeker(16)
5:43.543 aoe o arcane_explosion Fluffy_Pillow 41955.2/63371: 66% mana arcane_charge(2), clearcasting, thrill_seeker(16)
5:44.850 aoe o arcane_explosion Fluffy_Pillow 43611.7/63371: 69% mana arcane_charge(3), thrill_seeker(17)
5:46.157 aoe p arcane_barrage Fluffy_Pillow 40268.3/63371: 64% mana arcane_charge(4), thrill_seeker(18)
5:47.462 aoe o arcane_explosion Fluffy_Pillow 44457.1/63371: 70% mana thrill_seeker(18)
5:48.769 aoe o arcane_explosion Fluffy_Pillow 41113.6/63371: 65% mana arcane_charge, thrill_seeker(19)
5:50.076 aoe o arcane_explosion Fluffy_Pillow 37770.2/63371: 60% mana arcane_charge(2), thrill_seeker(20)
5:51.382 aoe o arcane_explosion Fluffy_Pillow 34425.4/63371: 54% mana arcane_charge(3), thrill_seeker(20)
5:52.688 aoe p arcane_barrage Fluffy_Pillow 31080.7/63371: 49% mana arcane_charge(4), thrill_seeker(21)
5:53.995 aoe n arcane_orb Fluffy_Pillow 35272.1/63371: 56% mana thrill_seeker(21)
5:55.302 aoe p arcane_barrage Fluffy_Pillow 36428.6/63371: 57% mana arcane_charge(4), thrill_seeker(22)
5:56.608 aoe o arcane_explosion Fluffy_Pillow 40618.7/63371: 64% mana thrill_seeker(23)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Venthyr_Nadjia"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=venthyr
soulbind=331586//arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Venthyr_Theotar : 10139 dps, 4196 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
10138.6 10138.6 11.8 / 0.116% 886.9 / 8.7% 4.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
2049.4 1962.6 Mana 0.00% 49.5 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Theotar 10139
Arcane Barrage 2839 28.0% 57.2 5.26sec 14935 11968 Direct 171.5 4181 8344 4987 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.24 171.47 0.00 0.00 1.2479 0.0000 854871.10 854871.10 0.00% 11967.96 11967.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 138.29 101 175 4180.84 2082 11728 4178.97 3796 4549 578066 578066 0.00%
crit 19.35% 33.18 16 54 8343.65 4164 23455 8332.73 5807 11678 276805 276805 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:57.24
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 271 2.7% 42.8 6.55sec 1907 0 Direct 128.5 533 1066 636 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.82 128.46 0.00 0.00 0.0000 0.0000 81668.91 81668.91 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 103.64 71 131 532.84 316 664 532.39 493 580 55217 55217 0.00%
crit 19.32% 24.82 9 44 1065.75 633 1329 1064.82 902 1248 26452 26452 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 5220 51.5% 154.4 1.92sec 10182 8194 Direct 463.1 2846 5691 3395 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 154.35 463.05 0.00 0.00 1.2425 0.0000 1571583.55 1571583.55 0.00% 8194.38 8194.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.71% 373.71 277 461 2845.62 2128 5017 2845.70 2745 2989 1063270 1063270 0.00%
crit 19.29% 89.34 56 129 5690.70 4256 10035 5691.07 5140 6361 508314 508314 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.546000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 54.6%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:154.35
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (864) 0.0% (8.5%) 13.2 23.49sec 19733 15824

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.18 0.00 0.00 0.00 1.2471 0.0000 0.00 0.00 0.00% 15823.53 15823.53

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [n]:13.18
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 864 8.5% 39.5 23.49sec 6588 0 Direct 39.5 5522 11042 6589 19.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.49 39.49 0.00 0.00 0.0000 0.0000 260154.68 260154.68 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 31.86 20 45 5522.11 3869 9122 5521.29 4570 6244 175889 175889 0.00%
crit 19.33% 7.63 0 18 11042.04 7739 18245 11030.80 0 18245 84266 84266 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (68) 0.0% (0.7%) 14.6 1.79sec 1390 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.60 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 68 0.7% 14.6 1.79sec 1390 0 Direct 14.6 1164 2327 1389 19.4%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.60 14.60 0.00 0.00 0.0000 0.0000 20288.07 20288.07 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.56% 11.76 6 20 1163.53 1164 1164 1163.53 1164 1164 13683 13683 0.00%
crit 19.44% 2.84 0 9 2327.06 2327 2327 2218.58 0 2327 6605 6605 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1767 19.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1767.48 1767.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.63% 0.81 0 1 1480.68 1481 1481 1193.87 0 1481 1194 1194 0.00%
crit 19.37% 0.19 0 1 2961.35 2961 2961 573.60 0 2961 574 574 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 6093 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 152  / 20 0.2% 90.0 1.29sec 68 52 Direct 90.0 57 114 68 19.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6092.80 6092.80 0.00% 51.73 51.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.81% 72.72 59 84 56.80 43 60 56.80 55 58 4131 4131 0.00%
crit 19.19% 17.28 6 31 113.56 86 120 113.53 101 120 1962 1962 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Mirrors of Torment 0 (145) 0.0% (1.4%) 2.7 141.48sec 16296 12475

Stats Details: Mirrors Of Torment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.68 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 12474.83 12474.83

Action Details: Mirrors Of Torment

  • id:314793
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • school:shadow
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by {$320035s3=15}%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].

Action Priority List

    aoe
    [j]:2.69
  • if_expr:(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
    Agonizing Backlash 64 0.6% 5.3 56.14sec 3637 0 Direct 5.3 3033 6170 3639 19.3%

Stats Details: Agonizing Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.30 5.30 0.00 0.00 0.0000 0.0000 19261.53 19261.53 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 4.27 0 6 3032.67 1739 3651 3012.01 0 3651 12960 12960 0.00%
crit 19.28% 1.02 0 4 6169.70 3477 7302 4099.25 0 7302 6302 6302 0.00%

Action Details: Agonizing Backlash

  • id:320035
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:320035
  • name:Agonizing Backlash
  • school:shadow
  • tooltip:Movement speed and cast speed slowed by {$s3=15}%.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
    Tormenting Backlash 81 0.8% 2.6 143.46sec 9490 0 Direct 2.6 7990 15984 9492 18.8%

Stats Details: Tormenting Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.58 2.58 0.00 0.00 0.0000 0.0000 24437.81 24437.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.23% 2.09 0 3 7990.21 6126 9188 7814.45 0 9188 16712 16712 0.00%
crit 18.77% 0.48 0 3 15983.96 12251 18377 6597.46 0 18377 7726 7726 0.00%

Action Details: Tormenting Backlash

  • id:317589
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.510000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:317589
  • name:Tormenting Backlash
  • school:shadow
  • tooltip:Rooted and Silenced.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
Touch of the Magi 0 (705) 0.0% (7.0%) 6.1 52.88sec 34970 27820

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.07 0.00 0.00 0.00 1.2571 0.0000 0.00 0.00 0.00% 27819.79 27819.79

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.10
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 705 7.0% 6.1 52.71sec 34970 0 Direct 18.2 11695 0 11695 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.07 18.16 0.00 0.00 0.0000 0.0000 212320.65 212320.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.16 15 21 11694.70 404 45164 11680.39 8640 14803 212321 212321 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:23511.84
  • base_dd_max:23511.84
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Venthyr_Theotar
Arcane Power 2.8 129.20sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.84
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 258.55sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:1.84
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.8 142.83sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.82 0.00 4.90 0.00 4.3083 0.7223 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.82
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 5.9 51.48sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.89 0.00 0.00 0.00 1.2556 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:5.91
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.02sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.72 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.72
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 58.0 155.1 5.2sec 1.4sec 3.8sec 72.89% 0.00% 0.4 (0.5) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s

Stack Uptimes

  • arcane_charge_1:18.64%
  • arcane_charge_2:16.30%
  • arcane_charge_3:16.47%
  • arcane_charge_4:21.47%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 129.4sec 129.4sec 14.7sec 13.80% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.7s / 137.6s
  • trigger_min/max:121.7s / 137.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:13.80%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 258.8sec 258.8sec 11.7sec 7.06% 23.64% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:250.2s / 264.3s
  • trigger_min/max:250.2s / 264.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • berserking_1:7.06%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.46% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.46%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.6 0.2 11.8sec 11.7sec 2.0sec 16.37% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.18%
  • clearcasting_2:0.20%
  • clearcasting_3:0.01%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.8 0.0 172.7sec 172.7sec 4.3sec 1.19% 0.00% 3.3 (3.3) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:112.8s / 257.8s
  • trigger_min/max:112.8s / 257.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:1.19%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.41% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.41%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.7 0.0 35.9sec 35.9sec 14.7sec 42.48% 0.00% 0.0 (0.0) 8.3

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.7s / 56.6s
  • trigger_min/max:15.7s / 56.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:42.48%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Soothing Shade 4.2 0.0 63.0sec 63.0sec 11.8sec 16.31% 0.00% 0.0 (0.0) 4.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_soothing_shade
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:525.00

Trigger Details

  • interval_min/max:20.0s / 217.9s
  • trigger_min/max:20.0s / 217.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • soothing_shade_1:16.31%

Spelldata

  • id:336885
  • name:Soothing Shade
  • tooltip:Standing in the shade makes it easier to focus, increasing your Mastery by $w1.
  • description:{$@spelldesc336239=Your spells and abilities have a chance to call Tubbins and Gubbins to your side for {$336808d=12 seconds}, parasol in hand. Standing in the shaded area grants you {$336885s1=525} Mastery.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.76% 0.77% 7.41% 0.8s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 301.2s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000181.223120.154239.984
Evocation183.15822.777352.253242.844139.896359.245
Rune of Power7.5031.14028.62946.48426.62058.481
Touch of the Magi5.8430.00027.34338.04625.31358.163
Arcane Power6.8811.68517.62519.9184.00926.618
Arcane Barrage2.7660.0029.577159.364124.786192.626
Arcane Orb3.4760.01210.48746.18532.43459.749
Mirrors of Torment29.4980.00074.54886.39459.820144.930

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Theotar
mana_regen Mana 520.12 376891.31 63.76% 724.63 13060.68 3.35%
Evocation Mana 39.25 39892.27 6.75% 1016.44 0.00 0.00%
Mana Gem Mana 2.72 17546.64 2.97% 6451.09 0.00 0.00%
Arcane Barrage Mana 57.24 140651.23 23.79% 2457.37 7731.30 5.21%
Mirrors of Torment Mana 7.87 16140.65 2.73% 2049.71 4277.40 20.95%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1962.57 2049.37 25055.3 36634.0 298.1 63371.4
Usage Type Count Total Avg RPE APR
Venthyr_Theotar
arcane_explosion Mana 154.3 589805.1 3821.3 3821.2 2.7
arcane_orb Mana 13.2 5897.5 447.4 447.3 44.1
mirrors_of_torment Mana 2.7 5364.5 2000.0 2000.5 8.1
touch_of_the_magi Mana 6.1 15177.1 2500.0 2499.7 14.0

Statistics & Data Analysis

Fight Length
Venthyr_Theotar Fight Length
Count 1523
Mean 301.22
Minimum 240.15
Maximum 359.98
Spread ( max - min ) 119.83
Range [ ( max - min ) / 2 * 100% ] 19.89%
DPS
Venthyr_Theotar Damage Per Second
Count 1523
Mean 10138.63
Minimum 9496.13
Maximum 10830.98
Spread ( max - min ) 1334.86
Range [ ( max - min ) / 2 * 100% ] 6.58%
Standard Deviation 234.4659
5th Percentile 9778.45
95th Percentile 10535.77
( 95th Percentile - 5th Percentile ) 757.31
Mean Distribution
Standard Deviation 6.0080
95.00% Confidence Interval ( 10126.86 - 10150.41 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2055
0.1 Scale Factor Error with Delta=300 470
0.05 Scale Factor Error with Delta=300 1878
0.01 Scale Factor Error with Delta=300 46930
Priority Target DPS
Venthyr_Theotar Priority Target Damage Per Second
Count 1523
Mean 4196.21
Minimum 3780.47
Maximum 4652.93
Spread ( max - min ) 872.46
Range [ ( max - min ) / 2 * 100% ] 10.40%
Standard Deviation 132.8811
5th Percentile 3994.85
95th Percentile 4429.40
( 95th Percentile - 5th Percentile ) 434.55
Mean Distribution
Standard Deviation 3.4050
95.00% Confidence Interval ( 4189.54 - 4202.88 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3853
0.1 Scale Factor Error with Delta=300 151
0.05 Scale Factor Error with Delta=300 603
0.01 Scale Factor Error with Delta=300 15074
DPS(e)
Venthyr_Theotar Damage Per Second (Effective)
Count 1523
Mean 10138.63
Minimum 9496.13
Maximum 10830.98
Spread ( max - min ) 1334.86
Range [ ( max - min ) / 2 * 100% ] 6.58%
Damage
Venthyr_Theotar Damage
Count 1523
Mean 3046353.77
Minimum 2365950.75
Maximum 3699595.50
Spread ( max - min ) 1333644.75
Range [ ( max - min ) / 2 * 100% ] 21.89%
DTPS
Venthyr_Theotar Damage Taken Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Theotar Healing Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Theotar Healing Per Second (Effective)
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Theotar Heal
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Theotar Healing Taken Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Theotar Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_TheotarTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Theotar Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
j 2.69 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.10 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.84 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 5.91 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
n 13.18 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 154.35 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 57.24 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.82 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.72 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 1.84 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjklstpnpoooopoooopoooompoooropnpoooopoooopoooopoooopnpoooopoooopkmpoooopnpoooopoooopoooopnpoooopoooopkmpoooopnpoooolpoooopoooropnpoooopoooopjkmpnpoooopoooopoooopnpoooopoooopoooopkmpnpoooopoooopooqoopnpoooopoooopkltpoooropnpoooopoooompoooopnpoooopoooopoooopnpoooopoooopjkmpnpoooopoooopoooopnpo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Venthyr_Theotar 63371.4/63371: 100% mana
Pre precombat R food Venthyr_Theotar 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j mirrors_of_torment Fluffy_Pillow 62371.4/63371: 98% mana
0:01.305 aoe k touch_of_the_magi Fluffy_Pillow 61375.2/63371: 97% mana bloodlust
0:02.311 aoe l arcane_power Fluffy_Pillow 60150.3/63371: 95% mana bloodlust, arcane_charge(4)
0:02.311 shared_cds s potion Fluffy_Pillow 60150.3/63371: 95% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:02.311 shared_cds t berserking Fluffy_Pillow 60150.3/63371: 95% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.311 aoe p arcane_barrage Fluffy_Pillow 60150.3/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.226 aoe n arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.141 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.055 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.969 aoe o arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.885 aoe o arcane_explosion Fluffy_Pillow 60690.8/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.800 aoe o arcane_explosion Fluffy_Pillow 59350.5/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.716 aoe p arcane_barrage Fluffy_Pillow 58011.5/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.631 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.545 aoe o arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.459 aoe o arcane_explosion Fluffy_Pillow 60688.3/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.375 aoe o arcane_explosion Fluffy_Pillow 59349.3/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.289 aoe p arcane_barrage Fluffy_Pillow 58007.7/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.205 aoe o arcane_explosion Fluffy_Pillow 61703.5/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:15.119 aoe o arcane_explosion Fluffy_Pillow 62896.8/63371: 99% mana bloodlust, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:16.125 aoe o arcane_explosion Fluffy_Pillow 61671.8/63371: 97% mana bloodlust, arcane_charge(2), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:17.134 aoe o arcane_explosion Fluffy_Pillow 62950.7/63371: 99% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:18.141 aoe m rune_of_power Fluffy_Pillow 61727.0/63371: 97% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:19.148 aoe p arcane_barrage Fluffy_Pillow 63003.3/63371: 99% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:20.153 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:21.159 aoe o arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:22.166 aoe o arcane_explosion Fluffy_Pillow 55922.8/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:23.173 shared_cds r use_mana_gem Venthyr_Theotar 52199.1/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.173 aoe o arcane_explosion Fluffy_Pillow 58536.2/63371: 92% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:24.181 aoe p arcane_barrage Fluffy_Pillow 54813.8/63371: 86% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:25.187 aoe n arcane_orb Fluffy_Pillow 58623.7/63371: 93% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:26.195 aoe p arcane_barrage Fluffy_Pillow 59401.2/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:27.202 aoe o arcane_explosion Fluffy_Pillow 63212.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:28.210 aoe o arcane_explosion Fluffy_Pillow 59490.0/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:29.216 aoe o arcane_explosion Fluffy_Pillow 55765.0/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power
0:30.223 aoe o arcane_explosion Fluffy_Pillow 52041.3/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power
0:31.228 aoe p arcane_barrage Fluffy_Pillow 48315.1/63371: 76% mana bloodlust, arcane_charge(4), rune_of_power
0:32.233 aoe o arcane_explosion Fluffy_Pillow 52123.7/63371: 82% mana bloodlust, rune_of_power
0:33.239 aoe o arcane_explosion Fluffy_Pillow 48398.7/63371: 76% mana bloodlust, arcane_charge, rune_of_power
0:34.245 aoe o arcane_explosion Fluffy_Pillow 44673.7/63371: 70% mana bloodlust, arcane_charge(2)
0:35.251 aoe o arcane_explosion Fluffy_Pillow 40948.8/63371: 65% mana bloodlust, arcane_charge(3)
0:36.259 aoe p arcane_barrage Fluffy_Pillow 37226.3/63371: 59% mana bloodlust, arcane_charge(4)
0:37.266 aoe o arcane_explosion Fluffy_Pillow 41037.5/63371: 65% mana bloodlust
0:38.272 aoe o arcane_explosion Fluffy_Pillow 37312.5/63371: 59% mana bloodlust, arcane_charge
0:39.278 aoe o arcane_explosion Fluffy_Pillow 33587.6/63371: 53% mana bloodlust, arcane_charge(2)
0:40.286 aoe o arcane_explosion Fluffy_Pillow 29865.1/63371: 47% mana bloodlust, arcane_charge(3), clearcasting
0:41.292 aoe p arcane_barrage Fluffy_Pillow 31140.2/63371: 49% mana arcane_charge(4)
0:42.600 aoe o arcane_explosion Fluffy_Pillow 35332.8/63371: 56% mana
0:43.905 aoe o arcane_explosion Fluffy_Pillow 31986.8/63371: 50% mana arcane_charge
0:45.211 aoe o arcane_explosion Fluffy_Pillow 28642.1/63371: 45% mana arcane_charge(2)
0:46.518 aoe o arcane_explosion Fluffy_Pillow 25298.6/63371: 40% mana arcane_charge(3)
0:47.828 aoe p arcane_barrage Fluffy_Pillow 21958.9/63371: 35% mana arcane_charge(4), clearcasting
0:49.135 aoe n arcane_orb Fluffy_Pillow 29864.2/72371: 41% mana clearcasting, soothing_shade
0:50.442 aoe p arcane_barrage Fluffy_Pillow 31256.0/72371: 43% mana arcane_charge(4), clearcasting, soothing_shade
0:51.747 aoe o arcane_explosion Fluffy_Pillow 36039.7/72371: 50% mana clearcasting, soothing_shade
0:53.052 aoe o arcane_explosion Fluffy_Pillow 37928.6/72371: 52% mana arcane_charge, soothing_shade
0:54.358 aoe o arcane_explosion Fluffy_Pillow 34819.0/72371: 48% mana arcane_charge(2), soothing_shade
0:55.664 aoe o arcane_explosion Fluffy_Pillow 31709.3/72371: 44% mana arcane_charge(3), soothing_shade
0:56.971 aoe p arcane_barrage Fluffy_Pillow 28601.1/72371: 40% mana arcane_charge(4), soothing_shade
0:58.276 aoe o arcane_explosion Fluffy_Pillow 33384.9/72371: 46% mana soothing_shade
0:59.583 aoe o arcane_explosion Fluffy_Pillow 30276.6/72371: 42% mana arcane_charge, soothing_shade
1:00.889 aoe o arcane_explosion Fluffy_Pillow 23788.5/63371: 38% mana arcane_charge(2)
1:02.194 aoe o arcane_explosion Fluffy_Pillow 20442.5/63371: 32% mana arcane_charge(3), clearcasting
1:03.504 aoe p arcane_barrage Fluffy_Pillow 22102.9/63371: 35% mana arcane_charge(4)
1:04.809 aoe k touch_of_the_magi Fluffy_Pillow 26291.7/63371: 41% mana
1:06.115 aoe m rune_of_power Fluffy_Pillow 25447.0/63371: 40% mana arcane_charge(4)
1:07.422 aoe p arcane_barrage Fluffy_Pillow 27103.5/63371: 43% mana arcane_charge(4), rune_of_power
1:08.727 aoe o arcane_explosion Fluffy_Pillow 31292.4/63371: 49% mana rune_of_power
1:10.033 aoe o arcane_explosion Fluffy_Pillow 27947.6/63371: 44% mana arcane_charge, rune_of_power
1:11.339 aoe o arcane_explosion Fluffy_Pillow 24602.9/63371: 39% mana arcane_charge(2), rune_of_power
1:12.644 aoe o arcane_explosion Fluffy_Pillow 21256.9/63371: 34% mana arcane_charge(3), rune_of_power
1:13.950 aoe p arcane_barrage Fluffy_Pillow 17912.1/63371: 28% mana arcane_charge(4), rune_of_power
1:15.255 aoe n arcane_orb Fluffy_Pillow 22101.0/63371: 35% mana rune_of_power
1:16.562 aoe p arcane_barrage Fluffy_Pillow 23257.5/63371: 37% mana arcane_charge(4), rune_of_power
1:17.870 aoe o arcane_explosion Fluffy_Pillow 27450.2/63371: 43% mana rune_of_power
1:19.176 aoe o arcane_explosion Fluffy_Pillow 24105.4/63371: 38% mana arcane_charge, rune_of_power
1:20.481 aoe o arcane_explosion Fluffy_Pillow 20759.4/63371: 33% mana arcane_charge(2), rune_of_power
1:21.788 aoe o arcane_explosion Fluffy_Pillow 17416.0/63371: 27% mana arcane_charge(3), rune_of_power
1:23.094 aoe p arcane_barrage Fluffy_Pillow 14071.2/63371: 22% mana arcane_charge(4), clearcasting
1:24.401 aoe o arcane_explosion Fluffy_Pillow 18262.6/63371: 29% mana clearcasting
1:25.707 aoe o arcane_explosion Fluffy_Pillow 19917.9/63371: 31% mana arcane_charge
1:27.013 aoe o arcane_explosion Fluffy_Pillow 16573.1/63371: 26% mana arcane_charge(2)
1:28.319 aoe o arcane_explosion Fluffy_Pillow 13228.4/63371: 21% mana arcane_charge(3), clearcasting
1:29.625 aoe p arcane_barrage Fluffy_Pillow 14883.7/63371: 23% mana arcane_charge(4)
1:30.932 aoe o arcane_explosion Fluffy_Pillow 19075.0/63371: 30% mana
1:32.241 aoe o arcane_explosion Fluffy_Pillow 15734.1/63371: 25% mana arcane_charge
1:33.547 aoe o arcane_explosion Fluffy_Pillow 12389.4/63371: 20% mana arcane_charge(2)
1:34.854 aoe o arcane_explosion Fluffy_Pillow 9045.9/63371: 14% mana arcane_charge(3)
1:36.161 aoe p arcane_barrage Fluffy_Pillow 5702.4/63371: 9% mana arcane_charge(4)
1:37.468 aoe n arcane_orb Fluffy_Pillow 9893.8/63371: 16% mana
1:38.773 aoe p arcane_barrage Fluffy_Pillow 11047.8/63371: 17% mana arcane_charge(4)
1:40.082 aoe o arcane_explosion Fluffy_Pillow 15241.7/63371: 24% mana
1:41.389 aoe o arcane_explosion Fluffy_Pillow 11898.3/63371: 19% mana arcane_charge, clearcasting
1:42.697 aoe o arcane_explosion Fluffy_Pillow 15481.3/72371: 21% mana arcane_charge(2), soothing_shade
1:44.005 aoe o arcane_explosion Fluffy_Pillow 12374.5/72371: 17% mana arcane_charge(3), soothing_shade
1:45.310 aoe p arcane_barrage Fluffy_Pillow 9263.4/72371: 13% mana arcane_charge(4), clearcasting, soothing_shade
1:46.616 aoe o arcane_explosion Fluffy_Pillow 14048.6/72371: 19% mana clearcasting, soothing_shade
1:47.922 aoe o arcane_explosion Fluffy_Pillow 15939.0/72371: 22% mana arcane_charge, soothing_shade
1:49.228 aoe o arcane_explosion Fluffy_Pillow 12829.3/72371: 18% mana arcane_charge(2), soothing_shade
1:50.536 aoe o arcane_explosion Fluffy_Pillow 9722.5/72371: 13% mana arcane_charge(3), soothing_shade
1:51.844 aoe p arcane_barrage Fluffy_Pillow 6615.8/72371: 9% mana arcane_charge(4), clearcasting, soothing_shade
1:53.151 aoe k touch_of_the_magi Fluffy_Pillow 11402.4/72371: 16% mana clearcasting, soothing_shade
1:54.457 aoe m rune_of_power Fluffy_Pillow 9139.7/63371: 14% mana arcane_charge(4), clearcasting
1:55.764 aoe p arcane_barrage Fluffy_Pillow 10796.2/63371: 17% mana arcane_charge(4), clearcasting(2), rune_of_power
1:57.070 aoe o arcane_explosion Fluffy_Pillow 14986.3/63371: 24% mana clearcasting(2), rune_of_power
1:58.377 aoe o arcane_explosion Fluffy_Pillow 16642.9/63371: 26% mana arcane_charge, clearcasting, rune_of_power
1:59.684 aoe o arcane_explosion Fluffy_Pillow 18299.4/63371: 29% mana arcane_charge(2), rune_of_power
2:00.988 aoe o arcane_explosion Fluffy_Pillow 14952.1/63371: 24% mana arcane_charge(3), clearcasting, rune_of_power
2:02.295 aoe p arcane_barrage Fluffy_Pillow 16608.6/63371: 26% mana arcane_charge(4), rune_of_power
2:03.602 aoe n arcane_orb Fluffy_Pillow 20800.0/63371: 33% mana rune_of_power
2:04.908 aoe p arcane_barrage Fluffy_Pillow 21955.3/63371: 35% mana arcane_charge(4), rune_of_power
2:06.215 aoe o arcane_explosion Fluffy_Pillow 26146.7/63371: 41% mana rune_of_power
2:07.522 aoe o arcane_explosion Fluffy_Pillow 22803.2/63371: 36% mana arcane_charge, rune_of_power
2:08.828 aoe o arcane_explosion Fluffy_Pillow 19458.5/63371: 31% mana arcane_charge(2), rune_of_power
2:10.135 aoe o arcane_explosion Fluffy_Pillow 16115.0/63371: 25% mana arcane_charge(3), rune_of_power
2:11.443 aoe l arcane_power Fluffy_Pillow 12772.8/63371: 20% mana arcane_charge(4), clearcasting
2:11.443 aoe p arcane_barrage Fluffy_Pillow 12772.8/63371: 20% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power
2:12.750 aoe o arcane_explosion Fluffy_Pillow 16964.2/63371: 27% mana arcane_power, clearcasting, rune_of_power
2:14.056 aoe o arcane_explosion Fluffy_Pillow 21263.8/72371: 29% mana arcane_charge, arcane_power, rune_of_power, soothing_shade
2:15.362 aoe o arcane_explosion Fluffy_Pillow 20654.1/72371: 29% mana arcane_charge(2), arcane_power, rune_of_power, soothing_shade
2:16.670 aoe o arcane_explosion Fluffy_Pillow 20047.4/72371: 28% mana arcane_charge(3), arcane_power, rune_of_power, soothing_shade
2:17.976 aoe p arcane_barrage Fluffy_Pillow 19437.7/72371: 27% mana arcane_charge(4), arcane_power, rune_of_power, soothing_shade
2:19.281 aoe o arcane_explosion Fluffy_Pillow 24221.5/72371: 33% mana arcane_power, rune_of_power, soothing_shade
2:20.587 aoe o arcane_explosion Fluffy_Pillow 23611.8/72371: 33% mana arcane_charge, arcane_power, rune_of_power, soothing_shade
2:21.894 aoe o arcane_explosion Fluffy_Pillow 23003.6/72371: 32% mana arcane_charge(2), arcane_power, rune_of_power, soothing_shade
2:23.202 shared_cds r use_mana_gem Venthyr_Theotar 22396.8/72371: 31% mana arcane_charge(3), arcane_power, rune_of_power, soothing_shade
2:23.202 aoe o arcane_explosion Fluffy_Pillow 29634.0/72371: 41% mana arcane_charge(3), arcane_power, rune_of_power, soothing_shade
2:24.508 aoe p arcane_barrage Fluffy_Pillow 29024.3/72371: 40% mana arcane_charge(4), arcane_power, rune_of_power, soothing_shade
2:25.813 aoe n arcane_orb Fluffy_Pillow 29603.7/63371: 47% mana arcane_power, rune_of_power
2:27.119 aoe p arcane_barrage Fluffy_Pillow 31009.0/63371: 49% mana arcane_charge(4)
2:28.426 aoe o arcane_explosion Fluffy_Pillow 35200.4/63371: 56% mana
2:29.733 aoe o arcane_explosion Fluffy_Pillow 31856.9/63371: 50% mana arcane_charge
2:31.038 aoe o arcane_explosion Fluffy_Pillow 28510.9/63371: 45% mana arcane_charge(2)
2:32.345 aoe o arcane_explosion Fluffy_Pillow 25167.4/63371: 40% mana arcane_charge(3)
2:33.651 aoe p arcane_barrage Fluffy_Pillow 21822.7/63371: 34% mana arcane_charge(4)
2:34.958 aoe o arcane_explosion Fluffy_Pillow 26014.1/63371: 41% mana
2:36.264 aoe o arcane_explosion Fluffy_Pillow 22669.3/63371: 36% mana arcane_charge
2:37.569 aoe o arcane_explosion Fluffy_Pillow 19323.3/63371: 30% mana arcane_charge(2)
2:38.876 aoe o arcane_explosion Fluffy_Pillow 15979.9/63371: 25% mana arcane_charge(3)
2:40.183 aoe p arcane_barrage Fluffy_Pillow 12636.4/63371: 20% mana arcane_charge(4)
2:41.488 aoe j mirrors_of_torment Fluffy_Pillow 16825.2/63371: 27% mana
2:42.794 aoe k touch_of_the_magi Fluffy_Pillow 16480.5/63371: 26% mana clearcasting
2:44.099 aoe m rune_of_power Fluffy_Pillow 15634.5/63371: 25% mana arcane_charge(4), clearcasting
2:45.406 aoe p arcane_barrage Fluffy_Pillow 19825.9/63371: 31% mana arcane_charge(4), clearcasting, rune_of_power
2:46.713 aoe n arcane_orb Fluffy_Pillow 24017.3/63371: 38% mana clearcasting, rune_of_power
2:48.021 aoe p arcane_barrage Fluffy_Pillow 25175.1/63371: 40% mana arcane_charge(4), clearcasting, rune_of_power
2:49.325 aoe o arcane_explosion Fluffy_Pillow 29362.7/63371: 46% mana clearcasting, rune_of_power
2:50.632 aoe o arcane_explosion Fluffy_Pillow 33554.0/63371: 53% mana arcane_charge, rune_of_power
2:51.940 aoe o arcane_explosion Fluffy_Pillow 30211.8/63371: 48% mana arcane_charge(2), rune_of_power
2:53.247 aoe o arcane_explosion Fluffy_Pillow 26868.4/63371: 42% mana arcane_charge(3), rune_of_power
2:54.553 aoe p arcane_barrage Fluffy_Pillow 23523.6/63371: 37% mana arcane_charge(4), rune_of_power
2:55.860 aoe o arcane_explosion Fluffy_Pillow 27715.0/63371: 44% mana rune_of_power
2:57.166 aoe o arcane_explosion Fluffy_Pillow 26905.1/63371: 42% mana arcane_charge, rune_of_power
2:58.472 aoe o arcane_explosion Fluffy_Pillow 23560.4/63371: 37% mana arcane_charge(2), rune_of_power
2:59.778 aoe o arcane_explosion Fluffy_Pillow 20215.7/63371: 32% mana arcane_charge(3), clearcasting, rune_of_power
3:01.084 aoe p arcane_barrage Fluffy_Pillow 21870.9/63371: 35% mana arcane_charge(4)
3:02.392 aoe o arcane_explosion Fluffy_Pillow 26063.6/63371: 41% mana
3:03.699 aoe o arcane_explosion Fluffy_Pillow 22720.1/63371: 36% mana arcane_charge, clearcasting
3:05.005 aoe o arcane_explosion Fluffy_Pillow 24375.4/63371: 38% mana arcane_charge(2)
3:06.312 aoe o arcane_explosion Fluffy_Pillow 21031.9/63371: 33% mana arcane_charge(3)
3:07.619 aoe p arcane_barrage Fluffy_Pillow 17688.4/63371: 28% mana arcane_charge(4), clearcasting
3:08.924 aoe n arcane_orb Fluffy_Pillow 21877.3/63371: 35% mana clearcasting
3:10.231 aoe p arcane_barrage Fluffy_Pillow 23033.8/63371: 36% mana arcane_charge(4), clearcasting
3:11.537 aoe o arcane_explosion Fluffy_Pillow 27223.9/63371: 43% mana clearcasting
3:12.845 aoe o arcane_explosion Fluffy_Pillow 28881.7/63371: 46% mana arcane_charge
3:14.152 aoe o arcane_explosion Fluffy_Pillow 25538.3/63371: 40% mana arcane_charge(2)
3:15.459 aoe o arcane_explosion Fluffy_Pillow 22194.8/63371: 35% mana arcane_charge(3)
3:16.766 aoe p arcane_barrage Fluffy_Pillow 18851.3/63371: 30% mana arcane_charge(4)
3:18.072 aoe o arcane_explosion Fluffy_Pillow 23041.4/63371: 36% mana
3:19.377 aoe o arcane_explosion Fluffy_Pillow 19695.4/63371: 31% mana arcane_charge
3:20.684 aoe o arcane_explosion Fluffy_Pillow 16352.0/63371: 26% mana arcane_charge(2)
3:21.991 aoe o arcane_explosion Fluffy_Pillow 13008.5/63371: 21% mana arcane_charge(3)
3:23.298 aoe p arcane_barrage Fluffy_Pillow 9665.0/63371: 15% mana arcane_charge(4)
3:24.605 aoe o arcane_explosion Fluffy_Pillow 13856.4/63371: 22% mana
3:25.911 aoe o arcane_explosion Fluffy_Pillow 10511.7/63371: 17% mana arcane_charge
3:27.221 aoe o arcane_explosion Fluffy_Pillow 7172.0/63371: 11% mana arcane_charge(2)
3:28.527 aoe o arcane_explosion Fluffy_Pillow 3827.3/63371: 6% mana arcane_charge(3), clearcasting
3:29.832 aoe p arcane_barrage Fluffy_Pillow 5481.2/63371: 9% mana arcane_charge(4)
3:31.139 aoe k touch_of_the_magi Fluffy_Pillow 9672.6/63371: 15% mana
3:32.445 aoe m rune_of_power Fluffy_Pillow 8827.9/63371: 14% mana arcane_charge(4)
3:33.750 aoe p arcane_barrage Fluffy_Pillow 10481.9/63371: 17% mana arcane_charge(4), rune_of_power
3:35.057 aoe n arcane_orb Fluffy_Pillow 14673.3/63371: 23% mana rune_of_power
3:36.364 aoe p arcane_barrage Fluffy_Pillow 15829.8/63371: 25% mana arcane_charge(4), rune_of_power
3:37.669 aoe o arcane_explosion Fluffy_Pillow 20018.7/63371: 32% mana rune_of_power
3:38.975 aoe o arcane_explosion Fluffy_Pillow 16673.9/63371: 26% mana arcane_charge, rune_of_power
3:40.282 aoe o arcane_explosion Fluffy_Pillow 13330.4/63371: 21% mana arcane_charge(2), rune_of_power
3:41.589 aoe o arcane_explosion Fluffy_Pillow 9987.0/63371: 16% mana arcane_charge(3), clearcasting, rune_of_power
3:42.895 aoe p arcane_barrage Fluffy_Pillow 11642.2/63371: 18% mana arcane_charge(4), rune_of_power
3:44.202 aoe o arcane_explosion Fluffy_Pillow 15833.6/63371: 25% mana rune_of_power
3:45.509 aoe o arcane_explosion Fluffy_Pillow 12490.2/63371: 20% mana arcane_charge, rune_of_power
3:46.815 aoe o arcane_explosion Fluffy_Pillow 9145.4/63371: 14% mana arcane_charge(2), rune_of_power
3:48.123 aoe o arcane_explosion Fluffy_Pillow 5803.2/63371: 9% mana arcane_charge(3), clearcasting, rune_of_power
3:49.430 aoe p arcane_barrage Fluffy_Pillow 7459.7/63371: 12% mana arcane_charge(4)
3:50.736 aoe o arcane_explosion Fluffy_Pillow 11649.9/63371: 18% mana
3:52.041 aoe o arcane_explosion Fluffy_Pillow 8303.9/63371: 13% mana arcane_charge
3:53.347 aoe q evocation Venthyr_Theotar 4959.1/63371: 8% mana arcane_charge(2)
3:57.690 aoe o arcane_explosion Fluffy_Pillow 58802.5/63371: 93% mana arcane_charge(2)
3:58.996 aoe o arcane_explosion Fluffy_Pillow 55457.8/63371: 88% mana arcane_charge(3)
4:00.304 aoe p arcane_barrage Fluffy_Pillow 52115.6/63371: 82% mana arcane_charge(4)
4:01.610 aoe n arcane_orb Fluffy_Pillow 56305.7/63371: 89% mana
4:02.916 aoe p arcane_barrage Fluffy_Pillow 57461.0/63371: 91% mana arcane_charge(4)
4:04.223 aoe o arcane_explosion Fluffy_Pillow 61652.3/63371: 97% mana
4:05.529 aoe o arcane_explosion Fluffy_Pillow 58307.6/63371: 92% mana arcane_charge
4:06.837 aoe o arcane_explosion Fluffy_Pillow 54965.4/63371: 87% mana arcane_charge(2)
4:08.143 aoe o arcane_explosion Fluffy_Pillow 51620.7/63371: 81% mana arcane_charge(3), clearcasting
4:09.449 aoe p arcane_barrage Fluffy_Pillow 53275.9/63371: 84% mana arcane_charge(4)
4:10.758 aoe o arcane_explosion Fluffy_Pillow 57469.8/63371: 91% mana
4:12.065 aoe o arcane_explosion Fluffy_Pillow 54126.4/63371: 85% mana arcane_charge
4:13.372 aoe o arcane_explosion Fluffy_Pillow 50782.9/63371: 80% mana arcane_charge(2), clearcasting
4:14.679 aoe o arcane_explosion Fluffy_Pillow 52439.4/63371: 83% mana arcane_charge(3)
4:15.986 aoe p arcane_barrage Fluffy_Pillow 49096.0/63371: 77% mana arcane_charge(4)
4:17.291 aoe k touch_of_the_magi Fluffy_Pillow 53284.8/63371: 84% mana
4:18.747 aoe l arcane_power Fluffy_Pillow 52630.2/63371: 83% mana arcane_charge(4)
4:18.747 shared_cds t berserking Fluffy_Pillow 52630.2/63371: 83% mana arcane_charge(4), arcane_power, rune_of_power
4:18.747 aoe p arcane_barrage Fluffy_Pillow 52630.2/63371: 83% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:19.936 aoe o arcane_explosion Fluffy_Pillow 56672.0/63371: 89% mana berserking, arcane_power, rune_of_power
4:21.124 aoe o arcane_explosion Fluffy_Pillow 55677.7/63371: 88% mana berserking, arcane_charge, arcane_power, rune_of_power
4:22.311 aoe o arcane_explosion Fluffy_Pillow 54682.2/63371: 86% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:23.499 shared_cds r use_mana_gem Venthyr_Theotar 53687.9/63371: 85% mana berserking, arcane_charge(3), arcane_power, rune_of_power
4:23.499 aoe o arcane_explosion Fluffy_Pillow 60025.0/63371: 95% mana berserking, arcane_charge(3), arcane_power, rune_of_power
4:24.689 aoe p arcane_barrage Fluffy_Pillow 59033.2/63371: 93% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power
4:25.877 aoe n arcane_orb Fluffy_Pillow 63073.8/63371: 100% mana berserking, arcane_power, clearcasting, rune_of_power
4:27.066 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power
4:28.254 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana berserking, arcane_power, clearcasting, rune_of_power
4:29.442 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana berserking, arcane_charge, arcane_power, rune_of_power
4:30.631 aoe o arcane_explosion Fluffy_Pillow 62378.4/63371: 98% mana berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power
4:31.821 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(3), arcane_power, rune_of_power
4:33.129 aoe p arcane_barrage Fluffy_Pillow 62529.2/63371: 99% mana arcane_charge(4), arcane_power, rune_of_power
4:34.435 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana
4:35.741 aoe o arcane_explosion Fluffy_Pillow 68551.7/72371: 95% mana arcane_charge, soothing_shade
4:37.046 aoe o arcane_explosion Fluffy_Pillow 65440.6/72371: 90% mana arcane_charge(2), soothing_shade
4:38.353 aoe o arcane_explosion Fluffy_Pillow 62332.4/72371: 86% mana arcane_charge(3), soothing_shade
4:39.660 aoe m rune_of_power Fluffy_Pillow 59224.1/72371: 82% mana arcane_charge(4), clearcasting, soothing_shade
4:40.967 aoe p arcane_barrage Fluffy_Pillow 61115.9/72371: 84% mana arcane_charge(4), clearcasting, rune_of_power, soothing_shade
4:42.274 aoe o arcane_explosion Fluffy_Pillow 65902.6/72371: 91% mana clearcasting, rune_of_power, soothing_shade
4:43.579 aoe o arcane_explosion Fluffy_Pillow 67791.5/72371: 94% mana arcane_charge, rune_of_power, soothing_shade
4:44.885 aoe o arcane_explosion Fluffy_Pillow 64681.8/72371: 89% mana arcane_charge(2), rune_of_power, soothing_shade
4:46.191 aoe o arcane_explosion Fluffy_Pillow 61572.2/72371: 85% mana arcane_charge(3), rune_of_power, soothing_shade
4:47.499 aoe p arcane_barrage Fluffy_Pillow 51194.7/63371: 81% mana arcane_charge(4), rune_of_power
4:48.805 aoe n arcane_orb Fluffy_Pillow 55384.8/63371: 87% mana rune_of_power
4:50.111 aoe p arcane_barrage Fluffy_Pillow 56540.1/63371: 89% mana arcane_charge(4), rune_of_power
4:51.418 aoe o arcane_explosion Fluffy_Pillow 60731.5/63371: 96% mana rune_of_power
4:52.726 aoe o arcane_explosion Fluffy_Pillow 57389.3/63371: 91% mana arcane_charge, rune_of_power
4:54.033 aoe o arcane_explosion Fluffy_Pillow 54045.8/63371: 85% mana arcane_charge(2), rune_of_power
4:55.340 aoe o arcane_explosion Fluffy_Pillow 50702.3/63371: 80% mana arcane_charge(3), rune_of_power
4:56.646 aoe p arcane_barrage Fluffy_Pillow 47357.6/63371: 75% mana arcane_charge(4), clearcasting
4:57.952 aoe o arcane_explosion Fluffy_Pillow 51547.7/63371: 81% mana clearcasting
4:59.258 aoe o arcane_explosion Fluffy_Pillow 53203.0/63371: 84% mana arcane_charge
5:00.564 aoe o arcane_explosion Fluffy_Pillow 56939.1/72371: 79% mana arcane_charge(2), soothing_shade
5:01.872 aoe o arcane_explosion Fluffy_Pillow 53832.3/72371: 74% mana arcane_charge(3), soothing_shade
5:03.177 aoe p arcane_barrage Fluffy_Pillow 50721.2/72371: 70% mana arcane_charge(4), clearcasting, soothing_shade
5:04.483 aoe o arcane_explosion Fluffy_Pillow 55506.4/72371: 77% mana clearcasting, soothing_shade
5:05.791 aoe o arcane_explosion Fluffy_Pillow 57399.7/72371: 79% mana arcane_charge, soothing_shade
5:07.098 aoe o arcane_explosion Fluffy_Pillow 54291.5/72371: 75% mana arcane_charge(2), clearcasting, soothing_shade
5:08.405 aoe o arcane_explosion Fluffy_Pillow 56183.3/72371: 78% mana arcane_charge(3), soothing_shade
5:09.710 aoe p arcane_barrage Fluffy_Pillow 53072.2/72371: 73% mana arcane_charge(4), soothing_shade
5:11.017 aoe n arcane_orb Fluffy_Pillow 57858.8/72371: 80% mana soothing_shade
5:12.322 aoe p arcane_barrage Fluffy_Pillow 51879.7/63371: 82% mana arcane_charge(4)
5:13.629 aoe o arcane_explosion Fluffy_Pillow 56071.1/63371: 88% mana
5:14.936 aoe o arcane_explosion Fluffy_Pillow 52727.7/63371: 83% mana arcane_charge
5:16.243 aoe o arcane_explosion Fluffy_Pillow 49384.2/63371: 78% mana arcane_charge(2)
5:17.550 aoe o arcane_explosion Fluffy_Pillow 46040.7/63371: 73% mana arcane_charge(3), clearcasting
5:18.855 aoe p arcane_barrage Fluffy_Pillow 47694.7/63371: 75% mana arcane_charge(4)
5:20.162 aoe o arcane_explosion Fluffy_Pillow 51886.1/63371: 82% mana
5:21.467 aoe o arcane_explosion Fluffy_Pillow 48540.1/63371: 77% mana arcane_charge
5:22.775 aoe o arcane_explosion Fluffy_Pillow 45197.9/63371: 71% mana arcane_charge(2), clearcasting
5:24.080 aoe o arcane_explosion Fluffy_Pillow 46851.9/63371: 74% mana arcane_charge(3)
5:25.387 aoe p arcane_barrage Fluffy_Pillow 43508.4/63371: 69% mana arcane_charge(4), clearcasting
5:26.691 aoe j mirrors_of_torment Fluffy_Pillow 47696.0/63371: 75% mana clearcasting
5:27.998 aoe k touch_of_the_magi Fluffy_Pillow 47352.5/63371: 75% mana clearcasting
5:29.303 aoe m rune_of_power Fluffy_Pillow 46506.5/63371: 73% mana arcane_charge(4), clearcasting
5:30.611 aoe p arcane_barrage Fluffy_Pillow 50699.2/63371: 80% mana arcane_charge(4), clearcasting, rune_of_power
5:31.917 aoe n arcane_orb Fluffy_Pillow 54889.3/63371: 87% mana clearcasting, rune_of_power
5:33.222 aoe p arcane_barrage Fluffy_Pillow 56043.3/63371: 88% mana arcane_charge(4), clearcasting, rune_of_power
5:34.528 aoe o arcane_explosion Fluffy_Pillow 60233.4/63371: 95% mana clearcasting, rune_of_power
5:35.835 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge, rune_of_power
5:37.141 aoe o arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge(2), rune_of_power
5:38.448 aoe o arcane_explosion Fluffy_Pillow 56683.2/63371: 89% mana arcane_charge(3), rune_of_power
5:39.756 aoe p arcane_barrage Fluffy_Pillow 53341.0/63371: 84% mana arcane_charge(4), rune_of_power
5:41.063 aoe o arcane_explosion Fluffy_Pillow 57532.4/63371: 91% mana rune_of_power
5:42.369 aoe o arcane_explosion Fluffy_Pillow 56722.5/63371: 90% mana arcane_charge, rune_of_power
5:43.676 aoe o arcane_explosion Fluffy_Pillow 60959.9/72371: 84% mana arcane_charge(2), clearcasting, rune_of_power, soothing_shade
5:44.984 aoe o arcane_explosion Fluffy_Pillow 62853.2/72371: 87% mana arcane_charge(3), rune_of_power, soothing_shade
5:46.290 aoe p arcane_barrage Fluffy_Pillow 59743.5/72371: 83% mana arcane_charge(4), clearcasting, soothing_shade
5:47.596 aoe o arcane_explosion Fluffy_Pillow 64528.7/72371: 89% mana clearcasting, soothing_shade
5:48.900 aoe o arcane_explosion Fluffy_Pillow 66416.2/72371: 92% mana arcane_charge, soothing_shade
5:50.206 aoe o arcane_explosion Fluffy_Pillow 63306.5/72371: 87% mana arcane_charge(2), soothing_shade
5:51.512 aoe o arcane_explosion Fluffy_Pillow 60196.8/72371: 83% mana arcane_charge(3), soothing_shade
5:52.817 aoe p arcane_barrage Fluffy_Pillow 57085.7/72371: 79% mana arcane_charge(4), soothing_shade
5:54.126 aoe n arcane_orb Fluffy_Pillow 61875.3/72371: 85% mana soothing_shade
5:55.432 aoe p arcane_barrage Fluffy_Pillow 55398.0/63371: 87% mana arcane_charge(4)
5:56.739 aoe o arcane_explosion Fluffy_Pillow 59589.4/63371: 94% mana

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Venthyr_Theotar"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=venthyr
soulbind=336239//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

arcane : 9612 dps, 3887 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9611.9 9611.9 11.0 / 0.115% 854.5 / 8.9% 4.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
2051.2 1949.1 Mana 0.00% 49.4 100.0% 100%
Talents

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
arcane 9612
Arcane Barrage 2820 29.4% 57.5 5.25sec 14775 11889 Direct 172.2 4140 8266 4931 19.2%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.47 172.21 0.00 0.00 1.2428 0.0000 849087.63 849087.63 0.00% 11888.82 11888.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.81% 139.16 102 176 4139.50 1772 10930 4137.84 3718 4463 576001 576001 0.00%
crit 19.19% 33.05 17 54 8265.80 3545 21861 8263.12 5722 11303 273087 273087 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [o]:57.46
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
    rotation
    [q]:0.00
Arcane Echo 234 2.4% 36.9 7.72sec 1906 0 Direct 110.7 532 1063 636 19.5%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.89 110.67 0.00 0.00 0.0000 0.0000 70324.83 70324.83 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.53% 89.13 60 119 532.08 443 664 531.62 496 561 47417 47417 0.00%
crit 19.47% 21.54 8 38 1063.48 886 1329 1062.93 914 1225 22908 22908 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 5157 53.7% 155.5 1.91sec 9985 8034 Direct 466.4 2789 5579 3329 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 155.46 466.38 0.00 0.00 1.2428 0.0000 1552196.40 1552196.40 0.00% 8033.64 8033.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 376.16 286 476 2788.84 2128 4469 2789.48 2695 2887 1048952 1048952 0.00%
crit 19.34% 90.22 53 139 5579.21 4256 8938 5578.50 4923 6175 503245 503245 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.546000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 54.6%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [n]:155.46
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (853) 0.0% (8.9%) 13.2 23.67sec 19500 15637

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.16 0.00 0.00 0.00 1.2471 0.0000 0.00 0.00 0.00% 15637.12 15637.12

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.16
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 853 8.9% 39.4 23.67sec 6514 0 Direct 39.4 5463 10886 6515 19.4%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.41 39.41 0.00 0.00 0.0000 0.0000 256683.31 256683.31 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.60% 31.76 19 45 5463.21 3869 8126 5461.50 4795 5959 173483 173483 0.00%
crit 19.40% 7.65 1 17 10885.87 7739 16251 10868.51 7739 14897 83200 83200 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (67) 0.0% (0.7%) 14.4 1.78sec 1386 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.44 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 67 0.7% 14.4 1.78sec 1386 0 Direct 14.4 1164 2327 1386 19.1%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.44 14.44 0.00 0.00 0.0000 0.0000 20007.70 20007.70 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.88% 11.67 6 21 1163.53 1164 1164 1163.53 1164 1164 13584 13584 0.00%
crit 19.12% 2.76 0 9 2327.06 2327 2327 2184.96 0 2327 6423 6423 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.1% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1770 19.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1768.45 1768.45 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.56% 0.81 0 1 1480.68 1481 1481 1192.90 0 1481 1193 1193 0.00%
crit 19.44% 0.19 0 1 2961.35 2961 2961 575.55 0 2961 576 576 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 6043 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 151  / 20 0.2% 90.0 1.29sec 67 51 Direct 90.0 56 112 67 19.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6042.97 6042.97 0.00% 51.31 51.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.57% 72.51 58 84 56.24 43 60 56.23 55 58 4078 4078 0.00%
crit 19.43% 17.49 6 32 112.36 86 120 112.38 102 120 1965 1965 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (455) 0.0% (4.7%) 6.1 52.47sec 22243 17025

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.15 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 17024.84 17024.84

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.17
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 455 4.7% 6.1 52.36sec 22243 0 Direct 18.4 7434 0 7434 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.15 18.40 0.00 0.00 0.0000 0.0000 136743.50 136743.50 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.40 15 21 7433.53 1115 29192 7430.64 5615 10009 136744 136744 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:15861.43
  • base_dd_max:15861.43
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
arcane
Arcane Power 2.9 128.39sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.86 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:2.86
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.9 256.47sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.86 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:1.86
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.2 173.40sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.20 0.00 7.17 0.00 4.3050 0.7221 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [p]:1.20
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.0 50.93sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.95 0.00 0.00 0.00 1.2561 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:5.98
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 123.51sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.77 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.77
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 58.2 156.0 5.2sec 1.4sec 3.8sec 73.99% 0.00% 0.8 (0.9) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 12.3s
  • trigger_min/max:0.0s / 7.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.6s

Stack Uptimes

  • arcane_charge_1:19.06%
  • arcane_charge_2:16.48%
  • arcane_charge_3:16.88%
  • arcane_charge_4:21.58%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 128.4sec 128.4sec 14.7sec 13.93% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.8s / 136.8s
  • trigger_min/max:120.8s / 136.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:13.93%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.9 0.0 256.6sec 256.6sec 11.7sec 7.17% 23.81% 0.0 (0.0) 1.8

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:253.9s / 265.7s
  • trigger_min/max:253.9s / 265.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:7.17%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.46% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.46%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.5 0.1 11.9sec 11.8sec 1.9sec 15.74% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.65%
  • clearcasting_2:0.11%
  • clearcasting_3:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 1.2 0.0 169.5sec 169.5sec 4.3sec 1.72% 0.00% 4.8 (4.8) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:93.2s / 269.6s
  • trigger_min/max:93.2s / 269.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.3s

Stack Uptimes

  • evocation_1:1.72%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.41% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.41%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.8 0.0 35.6sec 35.6sec 14.7sec 42.95% 0.00% 0.0 (0.0) 8.4

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.7s / 52.7s
  • trigger_min/max:15.7s / 52.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • rune_of_power_1:42.95%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=15 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 3 0.00% 0.00% 1.89%
Arcane Barrage Arcane Charge 4 100.00% 98.11% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.02% 0.76% 5.50% 0.9s 0.0s 3.9s
Conserve Phase 100.00% 100.00% 100.00% 301.2s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000181.223120.154239.984
Evocation140.9203.182332.648210.219115.190332.648
Rune of Power6.8840.00727.31243.33022.87758.746
Touch of the Magi5.1340.00027.58334.04721.27157.139
Arcane Power5.9430.77416.75717.2139.21927.006
Arcane Barrage2.7470.0008.279158.990126.331192.069
Arcane Orb3.5300.01010.48846.80833.74561.190

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
arcane
mana_regen Mana 491.85 371812.91 63.34% 755.95 9287.33 2.44%
Evocation Mana 57.33 57631.69 9.82% 1005.26 0.00 0.00%
Mana Gem Mana 2.77 17549.64 2.99% 6337.14 0.00 0.00%
Arcane Barrage Mana 57.46 140005.69 23.85% 2436.52 5649.36 3.88%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1949.10 2051.23 14938.5 32605.5 8.3 63371.4
Usage Type Count Total Avg RPE APR
arcane
arcane_explosion Mana 155.5 595524.7 3830.6 3830.8 2.6
arcane_orb Mana 13.2 5876.5 446.5 446.4 43.7
touch_of_the_magi Mana 6.1 15365.5 2500.0 2499.4 8.9

Statistics & Data Analysis

Fight Length
arcane Fight Length
Count 1523
Mean 301.22
Minimum 240.15
Maximum 359.98
Spread ( max - min ) 119.83
Range [ ( max - min ) / 2 * 100% ] 19.89%
DPS
arcane Damage Per Second
Count 1523
Mean 9611.88
Minimum 8905.84
Maximum 10390.25
Spread ( max - min ) 1484.41
Range [ ( max - min ) / 2 * 100% ] 7.72%
Standard Deviation 219.2548
5th Percentile 9266.93
95th Percentile 9988.66
( 95th Percentile - 5th Percentile ) 721.73
Mean Distribution
Standard Deviation 5.6182
95.00% Confidence Interval ( 9600.87 - 9622.89 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1999
0.1 Scale Factor Error with Delta=300 411
0.05 Scale Factor Error with Delta=300 1642
0.01 Scale Factor Error with Delta=300 41038
Priority Target DPS
arcane Priority Target Damage Per Second
Count 1523
Mean 3886.83
Minimum 3543.21
Maximum 4315.36
Spread ( max - min ) 772.15
Range [ ( max - min ) / 2 * 100% ] 9.93%
Standard Deviation 122.2914
5th Percentile 3690.05
95th Percentile 4097.21
( 95th Percentile - 5th Percentile ) 407.16
Mean Distribution
Standard Deviation 3.1336
95.00% Confidence Interval ( 3880.68 - 3892.97 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3803
0.1 Scale Factor Error with Delta=300 128
0.05 Scale Factor Error with Delta=300 511
0.01 Scale Factor Error with Delta=300 12767
DPS(e)
arcane Damage Per Second (Effective)
Count 1523
Mean 9611.88
Minimum 8905.84
Maximum 10390.25
Spread ( max - min ) 1484.41
Range [ ( max - min ) / 2 * 100% ] 7.72%
Damage
arcane Damage
Count 1523
Mean 2886811.83
Minimum 2212994.59
Maximum 3482223.58
Spread ( max - min ) 1269228.98
Range [ ( max - min ) / 2 * 100% ] 21.98%
DTPS
arcane Damage Taken Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
arcane Healing Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
arcane Healing Per Second (Effective)
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
arcane Heal
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
arcane Healing Taken Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
arcane Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
arcaneTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
arcane Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.17 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 2.86 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 5.98 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.16 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
n 155.46 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
o 57.46 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
p 1.20 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation
# count action,conditions
0.00 variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
0.00 strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
0.00 arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
0.00 arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
0.00 arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
0.00 arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
0.00 arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
0.00 arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
0.00 supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
0.00 arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_blast
0.00 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
q 0.00 arcane_barrage
actions.shared_cds
# count action,conditions
r 2.77 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 1.86 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjkstomonnnnonnnnonnnnlonnnnromonnnnonnnnonnnnonnnnomonnnnonnnnojlonnnnomonnnnonnnnonnnnomonnnnonpjlonnnnomonnnnkonnnnonnnnomonnnnonnnnojlonnnrnomonnnnonnnnonnnnomonnnnonnnnojlonnnnomonnnnonnnnonnnnomonnnnonnnnojktonnnnomonnnnonnnnlonnnnormonnnnonnnnonnnnomonnnnonnnnojlonnnnomonnnnonnnnonnnno

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask arcane 63371.4/63371: 100% mana
Pre precombat R food arcane 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana
0:01.307 aoe k arcane_power Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4)
0:01.307 shared_cds s potion Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:01.307 shared_cds t berserking Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:01.307 aoe o arcane_barrage Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.221 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.136 aoe o arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.051 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.964 aoe n arcane_explosion Fluffy_Pillow 62028.6/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.877 aoe n arcane_explosion Fluffy_Pillow 60685.8/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.793 aoe n arcane_explosion Fluffy_Pillow 59346.7/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.705 aoe o arcane_barrage Fluffy_Pillow 58002.6/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.619 aoe n arcane_explosion Fluffy_Pillow 61695.9/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.534 aoe n arcane_explosion Fluffy_Pillow 60355.6/63371: 95% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.450 aoe n arcane_explosion Fluffy_Pillow 59016.6/63371: 93% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.365 aoe n arcane_explosion Fluffy_Pillow 57676.3/63371: 91% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.280 aoe o arcane_barrage Fluffy_Pillow 56336.0/63371: 89% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.194 aoe n arcane_explosion Fluffy_Pillow 60029.2/63371: 95% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.108 aoe n arcane_explosion Fluffy_Pillow 58687.7/63371: 93% mana bloodlust, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:15.113 aoe n arcane_explosion Fluffy_Pillow 57461.4/63371: 91% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:16.119 aoe n arcane_explosion Fluffy_Pillow 56236.5/63371: 89% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:17.125 aoe l rune_of_power Fluffy_Pillow 55011.5/63371: 87% mana bloodlust, arcane_charge(4), clearcasting, potion_of_deathly_fixation
0:18.131 aoe o arcane_barrage Fluffy_Pillow 56286.5/63371: 89% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:19.138 aoe n arcane_explosion Fluffy_Pillow 60097.7/63371: 95% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:20.143 aoe n arcane_explosion Fluffy_Pillow 61371.5/63371: 97% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:21.148 aoe n arcane_explosion Fluffy_Pillow 57645.2/63371: 91% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:22.153 aoe n arcane_explosion Fluffy_Pillow 53919.0/63371: 85% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.160 shared_cds r use_mana_gem arcane 50195.3/63371: 79% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:23.160 aoe o arcane_barrage Fluffy_Pillow 56532.4/63371: 89% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:24.167 aoe m arcane_orb Fluffy_Pillow 60343.6/63371: 95% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:25.174 aoe o arcane_barrage Fluffy_Pillow 61119.9/63371: 96% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:26.181 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:27.188 aoe n arcane_explosion Fluffy_Pillow 59647.7/63371: 94% mana bloodlust, arcane_charge, clearcasting, rune_of_power
0:28.195 aoe n arcane_explosion Fluffy_Pillow 60924.0/63371: 96% mana bloodlust, arcane_charge(2), rune_of_power
0:29.200 aoe n arcane_explosion Fluffy_Pillow 57197.8/63371: 90% mana bloodlust, arcane_charge(3), rune_of_power
0:30.205 aoe o arcane_barrage Fluffy_Pillow 53471.6/63371: 84% mana bloodlust, arcane_charge(4), rune_of_power
0:31.210 aoe n arcane_explosion Fluffy_Pillow 57280.2/63371: 90% mana bloodlust, rune_of_power
0:32.217 aoe n arcane_explosion Fluffy_Pillow 53556.5/63371: 85% mana bloodlust, arcane_charge, rune_of_power
0:33.223 aoe n arcane_explosion Fluffy_Pillow 49831.5/63371: 79% mana bloodlust, arcane_charge(2)
0:34.232 aoe n arcane_explosion Fluffy_Pillow 46110.4/63371: 73% mana bloodlust, arcane_charge(3)
0:35.239 aoe o arcane_barrage Fluffy_Pillow 42386.7/63371: 67% mana bloodlust, arcane_charge(4)
0:36.246 aoe n arcane_explosion Fluffy_Pillow 46197.8/63371: 73% mana bloodlust
0:37.254 aoe n arcane_explosion Fluffy_Pillow 42475.4/63371: 67% mana bloodlust, arcane_charge
0:38.261 aoe n arcane_explosion Fluffy_Pillow 38751.7/63371: 61% mana bloodlust, arcane_charge(2)
0:39.267 aoe n arcane_explosion Fluffy_Pillow 35026.7/63371: 55% mana bloodlust, arcane_charge(3)
0:40.276 aoe o arcane_barrage Fluffy_Pillow 31305.5/63371: 49% mana bloodlust, arcane_charge(4)
0:41.283 aoe n arcane_explosion Fluffy_Pillow 35116.7/63371: 55% mana
0:42.590 aoe n arcane_explosion Fluffy_Pillow 31773.2/63371: 50% mana arcane_charge
0:43.894 aoe n arcane_explosion Fluffy_Pillow 28426.0/63371: 45% mana arcane_charge(2)
0:45.201 aoe n arcane_explosion Fluffy_Pillow 25082.5/63371: 40% mana arcane_charge(3)
0:46.508 aoe o arcane_barrage Fluffy_Pillow 21739.0/63371: 34% mana arcane_charge(4)
0:47.815 aoe m arcane_orb Fluffy_Pillow 25930.4/63371: 41% mana
0:49.121 aoe o arcane_barrage Fluffy_Pillow 27085.7/63371: 43% mana arcane_charge(4)
0:50.428 aoe n arcane_explosion Fluffy_Pillow 31277.1/63371: 49% mana
0:51.733 aoe n arcane_explosion Fluffy_Pillow 27931.0/63371: 44% mana arcane_charge
0:53.040 aoe n arcane_explosion Fluffy_Pillow 24587.6/63371: 39% mana arcane_charge(2)
0:54.347 aoe n arcane_explosion Fluffy_Pillow 21244.1/63371: 34% mana arcane_charge(3)
0:55.654 aoe o arcane_barrage Fluffy_Pillow 17900.6/63371: 28% mana arcane_charge(4), clearcasting
0:56.961 aoe n arcane_explosion Fluffy_Pillow 22092.0/63371: 35% mana clearcasting
0:58.268 aoe n arcane_explosion Fluffy_Pillow 23748.6/63371: 37% mana arcane_charge
0:59.574 aoe n arcane_explosion Fluffy_Pillow 20403.8/63371: 32% mana arcane_charge(2)
1:00.881 aoe n arcane_explosion Fluffy_Pillow 17060.3/63371: 27% mana arcane_charge(3), clearcasting
1:02.186 aoe o arcane_barrage Fluffy_Pillow 18714.3/63371: 30% mana arcane_charge(4)
1:03.492 aoe j touch_of_the_magi Fluffy_Pillow 22904.5/63371: 36% mana
1:04.798 aoe l rune_of_power Fluffy_Pillow 22059.7/63371: 35% mana arcane_charge(4)
1:06.104 aoe o arcane_barrage Fluffy_Pillow 23715.0/63371: 37% mana arcane_charge(4), rune_of_power
1:07.408 aoe n arcane_explosion Fluffy_Pillow 27902.6/63371: 44% mana rune_of_power
1:08.715 aoe n arcane_explosion Fluffy_Pillow 24559.1/63371: 39% mana arcane_charge, rune_of_power
1:10.021 aoe n arcane_explosion Fluffy_Pillow 21214.4/63371: 33% mana arcane_charge(2), rune_of_power
1:11.328 aoe n arcane_explosion Fluffy_Pillow 17870.9/63371: 28% mana arcane_charge(3), rune_of_power
1:12.634 aoe o arcane_barrage Fluffy_Pillow 14526.1/63371: 23% mana arcane_charge(4), clearcasting, rune_of_power
1:13.941 aoe m arcane_orb Fluffy_Pillow 18717.5/63371: 30% mana clearcasting, rune_of_power
1:15.248 aoe o arcane_barrage Fluffy_Pillow 19874.1/63371: 31% mana arcane_charge(4), clearcasting, rune_of_power
1:16.555 aoe n arcane_explosion Fluffy_Pillow 24065.4/63371: 38% mana clearcasting, rune_of_power
1:17.861 aoe n arcane_explosion Fluffy_Pillow 25720.7/63371: 41% mana arcane_charge, rune_of_power
1:19.167 aoe n arcane_explosion Fluffy_Pillow 22376.0/63371: 35% mana arcane_charge(2), rune_of_power
1:20.473 aoe n arcane_explosion Fluffy_Pillow 19031.2/63371: 30% mana arcane_charge(3), clearcasting, rune_of_power
1:21.782 aoe o arcane_barrage Fluffy_Pillow 20690.3/63371: 33% mana arcane_charge(4)
1:23.089 aoe n arcane_explosion Fluffy_Pillow 24881.7/63371: 39% mana
1:24.396 aoe n arcane_explosion Fluffy_Pillow 21538.2/63371: 34% mana arcane_charge
1:25.702 aoe n arcane_explosion Fluffy_Pillow 18193.5/63371: 29% mana arcane_charge(2)
1:27.009 aoe n arcane_explosion Fluffy_Pillow 14850.0/63371: 23% mana arcane_charge(3)
1:28.317 aoe o arcane_barrage Fluffy_Pillow 11507.8/63371: 18% mana arcane_charge(4)
1:29.624 aoe n arcane_explosion Fluffy_Pillow 15699.2/63371: 25% mana
1:30.930 aoe n arcane_explosion Fluffy_Pillow 12354.4/63371: 19% mana arcane_charge
1:32.236 aoe n arcane_explosion Fluffy_Pillow 9009.7/63371: 14% mana arcane_charge(2)
1:33.542 aoe n arcane_explosion Fluffy_Pillow 5665.0/63371: 9% mana arcane_charge(3)
1:34.848 aoe o arcane_barrage Fluffy_Pillow 2320.2/63371: 4% mana arcane_charge(4)
1:36.155 aoe m arcane_orb Fluffy_Pillow 6511.6/63371: 10% mana
1:37.461 aoe o arcane_barrage Fluffy_Pillow 7666.9/63371: 12% mana arcane_charge(4)
1:38.766 aoe n arcane_explosion Fluffy_Pillow 11855.7/63371: 19% mana
1:40.071 aoe n arcane_explosion Fluffy_Pillow 8509.7/63371: 13% mana arcane_charge
1:41.378 aoe n arcane_explosion Fluffy_Pillow 5166.3/63371: 8% mana arcane_charge(2), clearcasting
1:42.683 aoe n arcane_explosion Fluffy_Pillow 6820.2/63371: 11% mana arcane_charge(3)
1:43.989 aoe o arcane_barrage Fluffy_Pillow 3475.5/63371: 5% mana arcane_charge(4)
1:45.296 aoe n arcane_explosion Fluffy_Pillow 7666.9/63371: 12% mana
1:46.605 aoe p evocation arcane 4326.0/63371: 7% mana arcane_charge
1:50.950 aoe j touch_of_the_magi Fluffy_Pillow 58171.9/63371: 92% mana arcane_charge
1:52.257 aoe l rune_of_power Fluffy_Pillow 57328.4/63371: 90% mana arcane_charge(4)
1:53.564 aoe o arcane_barrage Fluffy_Pillow 58985.0/63371: 93% mana arcane_charge(4), rune_of_power
1:54.870 aoe n arcane_explosion Fluffy_Pillow 63175.1/63371: 100% mana rune_of_power
1:56.176 aoe n arcane_explosion Fluffy_Pillow 59830.3/63371: 94% mana arcane_charge, rune_of_power
1:57.480 aoe n arcane_explosion Fluffy_Pillow 56483.1/63371: 89% mana arcane_charge(2), rune_of_power
1:58.785 aoe n arcane_explosion Fluffy_Pillow 53137.1/63371: 84% mana arcane_charge(3), rune_of_power
2:00.091 aoe o arcane_barrage Fluffy_Pillow 49792.3/63371: 79% mana arcane_charge(4), rune_of_power
2:01.398 aoe m arcane_orb Fluffy_Pillow 53983.7/63371: 85% mana rune_of_power
2:02.704 aoe o arcane_barrage Fluffy_Pillow 55139.0/63371: 87% mana arcane_charge(4), rune_of_power
2:04.011 aoe n arcane_explosion Fluffy_Pillow 59330.4/63371: 94% mana rune_of_power
2:05.317 aoe n arcane_explosion Fluffy_Pillow 55985.6/63371: 88% mana arcane_charge, clearcasting, rune_of_power
2:06.625 aoe n arcane_explosion Fluffy_Pillow 57643.4/63371: 91% mana arcane_charge(2), rune_of_power
2:07.931 aoe n arcane_explosion Fluffy_Pillow 54298.7/63371: 86% mana arcane_charge(3), rune_of_power
2:09.238 aoe k arcane_power Fluffy_Pillow 50955.2/63371: 80% mana arcane_charge(4)
2:09.238 aoe o arcane_barrage Fluffy_Pillow 50955.2/63371: 80% mana arcane_charge(4), arcane_power, rune_of_power
2:10.544 aoe n arcane_explosion Fluffy_Pillow 55145.3/63371: 87% mana arcane_power, rune_of_power
2:11.849 aoe n arcane_explosion Fluffy_Pillow 54299.3/63371: 86% mana arcane_charge, arcane_power, rune_of_power
2:13.156 aoe n arcane_explosion Fluffy_Pillow 53455.8/63371: 84% mana arcane_charge(2), arcane_power, rune_of_power
2:14.464 aoe n arcane_explosion Fluffy_Pillow 52613.6/63371: 83% mana arcane_charge(3), arcane_power, clearcasting, rune_of_power
2:15.772 aoe o arcane_barrage Fluffy_Pillow 54271.4/63371: 86% mana arcane_charge(4), arcane_power, rune_of_power
2:17.078 aoe n arcane_explosion Fluffy_Pillow 58461.6/63371: 92% mana arcane_power, rune_of_power
2:18.384 aoe n arcane_explosion Fluffy_Pillow 57616.8/63371: 91% mana arcane_charge, arcane_power, rune_of_power
2:19.691 aoe n arcane_explosion Fluffy_Pillow 56773.3/63371: 90% mana arcane_charge(2), arcane_power, rune_of_power
2:20.998 aoe n arcane_explosion Fluffy_Pillow 55929.9/63371: 88% mana arcane_charge(3), arcane_power, clearcasting, rune_of_power
2:22.305 aoe o arcane_barrage Fluffy_Pillow 57586.4/63371: 91% mana arcane_charge(4), arcane_power, rune_of_power
2:23.612 aoe m arcane_orb Fluffy_Pillow 61777.8/63371: 97% mana arcane_power, rune_of_power
2:24.920 aoe o arcane_barrage Fluffy_Pillow 63185.6/63371: 100% mana arcane_charge(4)
2:26.227 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana
2:27.535 aoe n arcane_explosion Fluffy_Pillow 60029.2/63371: 95% mana arcane_charge, clearcasting
2:28.840 aoe n arcane_explosion Fluffy_Pillow 61683.2/63371: 97% mana arcane_charge(2)
2:30.146 aoe n arcane_explosion Fluffy_Pillow 58338.5/63371: 92% mana arcane_charge(3), clearcasting
2:31.454 aoe o arcane_barrage Fluffy_Pillow 59996.3/63371: 95% mana arcane_charge(4)
2:32.761 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana
2:34.069 aoe n arcane_explosion Fluffy_Pillow 60029.2/63371: 95% mana arcane_charge
2:35.375 aoe n arcane_explosion Fluffy_Pillow 56684.5/63371: 89% mana arcane_charge(2), clearcasting
2:36.680 aoe n arcane_explosion Fluffy_Pillow 58338.5/63371: 92% mana arcane_charge(3)
2:37.985 aoe o arcane_barrage Fluffy_Pillow 54992.5/63371: 87% mana arcane_charge(4)
2:39.293 aoe j touch_of_the_magi Fluffy_Pillow 59185.1/63371: 93% mana
2:40.598 aoe l rune_of_power Fluffy_Pillow 58339.1/63371: 92% mana arcane_charge(4)
2:41.904 aoe o arcane_barrage Fluffy_Pillow 59994.4/63371: 95% mana arcane_charge(4), rune_of_power
2:43.210 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
2:44.516 aoe n arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge, rune_of_power
2:45.822 aoe n arcane_explosion Fluffy_Pillow 56682.0/63371: 89% mana arcane_charge(2), rune_of_power
2:47.129 shared_cds r use_mana_gem arcane 53338.5/63371: 84% mana arcane_charge(3), rune_of_power
2:47.129 aoe n arcane_explosion Fluffy_Pillow 59675.6/63371: 94% mana arcane_charge(3), rune_of_power
2:48.436 aoe o arcane_barrage Fluffy_Pillow 56332.2/63371: 89% mana arcane_charge(4), rune_of_power
2:49.742 aoe m arcane_orb Fluffy_Pillow 60522.3/63371: 96% mana rune_of_power
2:51.049 aoe o arcane_barrage Fluffy_Pillow 61678.8/63371: 97% mana arcane_charge(4), rune_of_power
2:52.356 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
2:53.662 aoe n arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge, rune_of_power
2:54.969 aoe n arcane_explosion Fluffy_Pillow 56683.2/63371: 89% mana arcane_charge(2), clearcasting, rune_of_power
2:56.274 aoe n arcane_explosion Fluffy_Pillow 58337.2/63371: 92% mana arcane_charge(3), rune_of_power
2:57.580 aoe o arcane_barrage Fluffy_Pillow 54992.5/63371: 87% mana arcane_charge(4), clearcasting
2:58.886 aoe n arcane_explosion Fluffy_Pillow 59182.6/63371: 93% mana clearcasting
3:00.192 aoe n arcane_explosion Fluffy_Pillow 60837.9/63371: 96% mana arcane_charge
3:01.498 aoe n arcane_explosion Fluffy_Pillow 57493.1/63371: 91% mana arcane_charge(2)
3:02.804 aoe n arcane_explosion Fluffy_Pillow 54148.4/63371: 85% mana arcane_charge(3)
3:04.111 aoe o arcane_barrage Fluffy_Pillow 50804.9/63371: 80% mana arcane_charge(4)
3:05.417 aoe n arcane_explosion Fluffy_Pillow 54995.0/63371: 87% mana
3:06.724 aoe n arcane_explosion Fluffy_Pillow 51651.6/63371: 82% mana arcane_charge
3:08.032 aoe n arcane_explosion Fluffy_Pillow 48309.4/63371: 76% mana arcane_charge(2)
3:09.338 aoe n arcane_explosion Fluffy_Pillow 44964.6/63371: 71% mana arcane_charge(3), clearcasting
3:10.644 aoe o arcane_barrage Fluffy_Pillow 46619.9/63371: 74% mana arcane_charge(4)
3:11.950 aoe m arcane_orb Fluffy_Pillow 50810.0/63371: 80% mana
3:13.258 aoe o arcane_barrage Fluffy_Pillow 51967.8/63371: 82% mana arcane_charge(4)
3:14.564 aoe n arcane_explosion Fluffy_Pillow 56157.9/63371: 89% mana
3:15.871 aoe n arcane_explosion Fluffy_Pillow 52814.4/63371: 83% mana arcane_charge
3:17.178 aoe n arcane_explosion Fluffy_Pillow 49471.0/63371: 78% mana arcane_charge(2)
3:18.484 aoe n arcane_explosion Fluffy_Pillow 46126.2/63371: 73% mana arcane_charge(3)
3:19.791 aoe o arcane_barrage Fluffy_Pillow 42782.8/63371: 68% mana arcane_charge(4)
3:21.098 aoe n arcane_explosion Fluffy_Pillow 46974.1/63371: 74% mana
3:22.404 aoe n arcane_explosion Fluffy_Pillow 43629.4/63371: 69% mana arcane_charge
3:23.712 aoe n arcane_explosion Fluffy_Pillow 40287.2/63371: 64% mana arcane_charge(2)
3:25.019 aoe n arcane_explosion Fluffy_Pillow 36943.7/63371: 58% mana arcane_charge(3)
3:26.325 aoe o arcane_barrage Fluffy_Pillow 33599.0/63371: 53% mana arcane_charge(4), clearcasting
3:27.630 aoe j touch_of_the_magi Fluffy_Pillow 37787.8/63371: 60% mana clearcasting
3:28.935 aoe l rune_of_power Fluffy_Pillow 36941.8/63371: 58% mana arcane_charge(4), clearcasting
3:30.243 aoe o arcane_barrage Fluffy_Pillow 38599.6/63371: 61% mana arcane_charge(4), clearcasting, rune_of_power
3:31.551 aoe n arcane_explosion Fluffy_Pillow 42792.3/63371: 68% mana clearcasting, rune_of_power
3:32.855 aoe n arcane_explosion Fluffy_Pillow 44445.0/63371: 70% mana arcane_charge, rune_of_power
3:34.161 aoe n arcane_explosion Fluffy_Pillow 41100.3/63371: 65% mana arcane_charge(2), rune_of_power
3:35.468 aoe n arcane_explosion Fluffy_Pillow 37756.8/63371: 60% mana arcane_charge(3), rune_of_power
3:36.774 aoe o arcane_barrage Fluffy_Pillow 34412.1/63371: 54% mana arcane_charge(4), rune_of_power
3:38.080 aoe m arcane_orb Fluffy_Pillow 38602.2/63371: 61% mana rune_of_power
3:39.385 aoe o arcane_barrage Fluffy_Pillow 39756.2/63371: 63% mana arcane_charge(4), rune_of_power
3:40.691 aoe n arcane_explosion Fluffy_Pillow 43946.3/63371: 69% mana rune_of_power
3:41.998 aoe n arcane_explosion Fluffy_Pillow 40602.8/63371: 64% mana arcane_charge, rune_of_power
3:43.305 aoe n arcane_explosion Fluffy_Pillow 37259.4/63371: 59% mana arcane_charge(2), clearcasting, rune_of_power
3:44.611 aoe n arcane_explosion Fluffy_Pillow 38914.6/63371: 61% mana arcane_charge(3), rune_of_power
3:45.918 aoe o arcane_barrage Fluffy_Pillow 35571.2/63371: 56% mana arcane_charge(4)
3:47.225 aoe n arcane_explosion Fluffy_Pillow 39762.5/63371: 63% mana
3:48.532 aoe n arcane_explosion Fluffy_Pillow 36419.1/63371: 57% mana arcane_charge, clearcasting
3:49.839 aoe n arcane_explosion Fluffy_Pillow 38075.6/63371: 60% mana arcane_charge(2)
3:51.145 aoe n arcane_explosion Fluffy_Pillow 34730.9/63371: 55% mana arcane_charge(3)
3:52.452 aoe o arcane_barrage Fluffy_Pillow 31387.4/63371: 50% mana arcane_charge(4)
3:53.757 aoe n arcane_explosion Fluffy_Pillow 35576.2/63371: 56% mana
3:55.062 aoe n arcane_explosion Fluffy_Pillow 32230.2/63371: 51% mana arcane_charge
3:56.367 aoe n arcane_explosion Fluffy_Pillow 28884.2/63371: 46% mana arcane_charge(2), clearcasting
3:57.672 aoe n arcane_explosion Fluffy_Pillow 30538.2/63371: 48% mana arcane_charge(3)
3:58.977 aoe o arcane_barrage Fluffy_Pillow 27192.2/63371: 43% mana arcane_charge(4), clearcasting
4:00.285 aoe m arcane_orb Fluffy_Pillow 31384.9/63371: 50% mana clearcasting
4:01.591 aoe o arcane_barrage Fluffy_Pillow 32540.1/63371: 51% mana arcane_charge(4), clearcasting
4:02.898 aoe n arcane_explosion Fluffy_Pillow 36731.5/63371: 58% mana clearcasting
4:04.205 aoe n arcane_explosion Fluffy_Pillow 38388.0/63371: 61% mana arcane_charge
4:05.512 aoe n arcane_explosion Fluffy_Pillow 35044.6/63371: 55% mana arcane_charge(2)
4:06.816 aoe n arcane_explosion Fluffy_Pillow 31697.3/63371: 50% mana arcane_charge(3), clearcasting
4:08.123 aoe o arcane_barrage Fluffy_Pillow 33353.8/63371: 53% mana arcane_charge(4)
4:09.430 aoe n arcane_explosion Fluffy_Pillow 37545.2/63371: 59% mana
4:10.737 aoe n arcane_explosion Fluffy_Pillow 34201.7/63371: 54% mana arcane_charge
4:12.042 aoe n arcane_explosion Fluffy_Pillow 30855.7/63371: 49% mana arcane_charge(2)
4:13.347 aoe n arcane_explosion Fluffy_Pillow 27509.7/63371: 43% mana arcane_charge(3)
4:14.654 aoe o arcane_barrage Fluffy_Pillow 24166.3/63371: 38% mana arcane_charge(4)
4:15.961 aoe j touch_of_the_magi Fluffy_Pillow 28357.7/63371: 45% mana
4:17.267 aoe k arcane_power Fluffy_Pillow 27512.9/63371: 43% mana arcane_charge(4), clearcasting
4:17.267 shared_cds t berserking Fluffy_Pillow 27512.9/63371: 43% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power
4:17.267 aoe o arcane_barrage Fluffy_Pillow 27512.9/63371: 43% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power
4:18.454 aoe n arcane_explosion Fluffy_Pillow 31552.2/63371: 50% mana berserking, arcane_power, clearcasting, rune_of_power
4:19.643 aoe n arcane_explosion Fluffy_Pillow 33059.2/63371: 52% mana berserking, arcane_charge, arcane_power, rune_of_power
4:20.830 aoe n arcane_explosion Fluffy_Pillow 32063.6/63371: 51% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:22.019 aoe n arcane_explosion Fluffy_Pillow 31070.6/63371: 49% mana berserking, arcane_charge(3), arcane_power, rune_of_power
4:23.207 aoe o arcane_barrage Fluffy_Pillow 30076.3/63371: 47% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:24.395 aoe m arcane_orb Fluffy_Pillow 34116.9/63371: 54% mana berserking, arcane_power, rune_of_power
4:25.583 aoe o arcane_barrage Fluffy_Pillow 35372.6/63371: 56% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:26.771 aoe n arcane_explosion Fluffy_Pillow 39413.1/63371: 62% mana berserking, arcane_power, rune_of_power
4:27.959 aoe n arcane_explosion Fluffy_Pillow 38418.8/63371: 61% mana berserking, arcane_charge, arcane_power, rune_of_power
4:29.147 aoe n arcane_explosion Fluffy_Pillow 37424.5/63371: 59% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:30.335 aoe n arcane_explosion Fluffy_Pillow 36430.2/63371: 57% mana arcane_charge(3), arcane_power, rune_of_power
4:31.640 aoe o arcane_barrage Fluffy_Pillow 35584.2/63371: 56% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power
4:32.946 aoe n arcane_explosion Fluffy_Pillow 39774.4/63371: 63% mana clearcasting
4:34.253 aoe n arcane_explosion Fluffy_Pillow 41430.9/63371: 65% mana arcane_charge
4:35.560 aoe n arcane_explosion Fluffy_Pillow 38087.4/63371: 60% mana arcane_charge(2)
4:36.865 aoe n arcane_explosion Fluffy_Pillow 34741.4/63371: 55% mana arcane_charge(3)
4:38.172 aoe l rune_of_power Fluffy_Pillow 31397.9/63371: 50% mana arcane_charge(4)
4:39.478 aoe o arcane_barrage Fluffy_Pillow 33053.2/63371: 52% mana arcane_charge(4), rune_of_power
4:40.787 aoe n arcane_explosion Fluffy_Pillow 37247.1/63371: 59% mana rune_of_power
4:42.093 aoe n arcane_explosion Fluffy_Pillow 33902.4/63371: 53% mana arcane_charge, clearcasting, rune_of_power
4:43.400 aoe n arcane_explosion Fluffy_Pillow 35558.9/63371: 56% mana arcane_charge(2), rune_of_power
4:44.706 aoe n arcane_explosion Fluffy_Pillow 32214.2/63371: 51% mana arcane_charge(3), rune_of_power
4:46.011 aoe o arcane_barrage Fluffy_Pillow 28868.2/63371: 46% mana arcane_charge(4), rune_of_power
4:47.318 shared_cds r use_mana_gem arcane 33059.6/63371: 52% mana rune_of_power
4:47.318 aoe m arcane_orb Fluffy_Pillow 39396.7/63371: 62% mana rune_of_power
4:48.624 aoe o arcane_barrage Fluffy_Pillow 40552.0/63371: 64% mana arcane_charge(4), rune_of_power
4:49.932 aoe n arcane_explosion Fluffy_Pillow 44744.6/63371: 71% mana rune_of_power
4:51.238 aoe n arcane_explosion Fluffy_Pillow 41399.9/63371: 65% mana arcane_charge, rune_of_power
4:52.544 aoe n arcane_explosion Fluffy_Pillow 38055.1/63371: 60% mana arcane_charge(2), rune_of_power
4:53.849 aoe n arcane_explosion Fluffy_Pillow 34709.1/63371: 55% mana arcane_charge(3), clearcasting, rune_of_power
4:55.156 aoe o arcane_barrage Fluffy_Pillow 36365.7/63371: 57% mana arcane_charge(4)
4:56.461 aoe n arcane_explosion Fluffy_Pillow 40554.5/63371: 64% mana
4:57.767 aoe n arcane_explosion Fluffy_Pillow 37209.8/63371: 59% mana arcane_charge
4:59.073 aoe n arcane_explosion Fluffy_Pillow 33865.0/63371: 53% mana arcane_charge(2)
5:00.379 aoe n arcane_explosion Fluffy_Pillow 30520.3/63371: 48% mana arcane_charge(3)
5:01.687 aoe o arcane_barrage Fluffy_Pillow 27178.1/63371: 43% mana arcane_charge(4)
5:02.993 aoe n arcane_explosion Fluffy_Pillow 31368.2/63371: 49% mana
5:04.300 aoe n arcane_explosion Fluffy_Pillow 28024.7/63371: 44% mana arcane_charge
5:05.609 aoe n arcane_explosion Fluffy_Pillow 24683.8/63371: 39% mana arcane_charge(2)
5:06.914 aoe n arcane_explosion Fluffy_Pillow 21337.8/63371: 34% mana arcane_charge(3)
5:08.222 aoe o arcane_barrage Fluffy_Pillow 17995.6/63371: 28% mana arcane_charge(4), clearcasting
5:09.526 aoe m arcane_orb Fluffy_Pillow 22183.2/63371: 35% mana clearcasting
5:10.832 aoe o arcane_barrage Fluffy_Pillow 23338.4/63371: 37% mana arcane_charge(4), clearcasting
5:12.138 aoe n arcane_explosion Fluffy_Pillow 27528.6/63371: 43% mana clearcasting
5:13.445 aoe n arcane_explosion Fluffy_Pillow 29185.1/63371: 46% mana arcane_charge
5:14.748 aoe n arcane_explosion Fluffy_Pillow 25836.5/63371: 41% mana arcane_charge(2)
5:16.054 aoe n arcane_explosion Fluffy_Pillow 22491.8/63371: 35% mana arcane_charge(3), clearcasting
5:17.362 aoe o arcane_barrage Fluffy_Pillow 24149.6/63371: 38% mana arcane_charge(4)
5:18.669 aoe n arcane_explosion Fluffy_Pillow 28341.0/63371: 45% mana
5:19.975 aoe n arcane_explosion Fluffy_Pillow 24996.3/63371: 39% mana arcane_charge
5:21.281 aoe n arcane_explosion Fluffy_Pillow 21651.5/63371: 34% mana arcane_charge(2)
5:22.587 aoe n arcane_explosion Fluffy_Pillow 18306.8/63371: 29% mana arcane_charge(3), clearcasting
5:23.893 aoe o arcane_barrage Fluffy_Pillow 19962.0/63371: 32% mana arcane_charge(4)
5:25.199 aoe j touch_of_the_magi Fluffy_Pillow 24152.2/63371: 38% mana
5:26.505 aoe l rune_of_power Fluffy_Pillow 23307.4/63371: 37% mana arcane_charge(4)
5:27.812 aoe o arcane_barrage Fluffy_Pillow 24963.9/63371: 39% mana arcane_charge(4), rune_of_power
5:29.116 aoe n arcane_explosion Fluffy_Pillow 29151.5/63371: 46% mana rune_of_power
5:30.423 aoe n arcane_explosion Fluffy_Pillow 25808.1/63371: 41% mana arcane_charge, rune_of_power
5:31.730 aoe n arcane_explosion Fluffy_Pillow 22464.6/63371: 35% mana arcane_charge(2), rune_of_power
5:33.037 aoe n arcane_explosion Fluffy_Pillow 19121.1/63371: 30% mana arcane_charge(3), rune_of_power
5:34.342 aoe o arcane_barrage Fluffy_Pillow 15775.1/63371: 25% mana arcane_charge(4), clearcasting, rune_of_power
5:35.648 aoe m arcane_orb Fluffy_Pillow 19965.2/63371: 32% mana clearcasting, rune_of_power
5:36.954 aoe o arcane_barrage Fluffy_Pillow 21120.5/63371: 33% mana arcane_charge(4), clearcasting, rune_of_power
5:38.262 aoe n arcane_explosion Fluffy_Pillow 25313.1/63371: 40% mana clearcasting, rune_of_power
5:39.569 aoe n arcane_explosion Fluffy_Pillow 26969.7/63371: 43% mana arcane_charge, rune_of_power
5:40.877 aoe n arcane_explosion Fluffy_Pillow 23627.5/63371: 37% mana arcane_charge(2), clearcasting, rune_of_power
5:42.183 aoe n arcane_explosion Fluffy_Pillow 25282.7/63371: 40% mana arcane_charge(3), rune_of_power
5:43.491 aoe o arcane_barrage Fluffy_Pillow 21940.5/63371: 35% mana arcane_charge(4), clearcasting
5:44.798 aoe n arcane_explosion Fluffy_Pillow 26131.9/63371: 41% mana clearcasting
5:46.105 aoe n arcane_explosion Fluffy_Pillow 27788.4/63371: 44% mana arcane_charge
5:47.414 aoe n arcane_explosion Fluffy_Pillow 24447.5/63371: 39% mana arcane_charge(2)
5:48.720 aoe n arcane_explosion Fluffy_Pillow 21102.8/63371: 33% mana arcane_charge(3)
5:50.027 aoe o arcane_barrage Fluffy_Pillow 17759.3/63371: 28% mana arcane_charge(4), clearcasting
5:51.332 aoe n arcane_explosion Fluffy_Pillow 21948.2/63371: 35% mana clearcasting
5:52.638 aoe n arcane_explosion Fluffy_Pillow 23603.4/63371: 37% mana arcane_charge
5:53.945 aoe n arcane_explosion Fluffy_Pillow 20259.9/63371: 32% mana arcane_charge(2)
5:55.252 aoe n arcane_explosion Fluffy_Pillow 16916.5/63371: 27% mana arcane_charge(3)
5:56.562 aoe o arcane_barrage Fluffy_Pillow 13576.8/63371: 21% mana arcane_charge(4)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="arcane"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Simulation & Raid Information

Iterations: 1539
Threads: 16
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 301.2 )

Performance:

Total Events Processed: 25768088
Max Event Queue: 245
Sim Seconds: 463583
CPU Seconds: 48.1875
Physical Seconds: 3.4341
Speed Up: 9620

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Kyrian_Forgelite Kyrian_Forgelite arcane_barrage 44425 839637 2787 33.17 4225 8492 55.6 166.5 19.2% 0.0% 0.0% 0.0% 5.42sec 839637 301.22sec
Kyrian_Forgelite Kyrian_Forgelite arcane_echo 342232 111851 371 35.42 528 1054 59.3 177.8 19.3% 0.0% 0.0% 0.0% 4.71sec 111851 301.22sec
Kyrian_Forgelite Kyrian_Forgelite arcane_explosion 1449 1513898 5026 89.24 2831 5666 149.3 448.0 19.4% 0.0% 0.0% 0.0% 1.98sec 1513898 301.22sec
Kyrian_Forgelite Kyrian_Forgelite arcane_orb 153626 0 0 0.00 0 0 12.8 0.0 0.0% 0.0% 0.0% 0.0% 24.14sec 0 301.22sec
Kyrian_Forgelite Kyrian_Forgelite arcane_orb_bolt 153640 253332 841 7.66 5530 11035 38.4 38.4 19.3% 0.0% 0.0% 0.0% 24.14sec 253332 301.22sec
Kyrian_Forgelite Kyrian_Forgelite arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 131.46sec 0 301.22sec
Kyrian_Forgelite Kyrian_Forgelite berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 262.76sec 0 301.22sec
Kyrian_Forgelite Kyrian_Forgelite conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Kyrian_Forgelite Kyrian_Forgelite deathly_fixation 322253 0 0 0.00 0 0 14.8 0.0 0.0% 0.0% 0.0% 0.0% 1.78sec 0 301.22sec
Kyrian_Forgelite Kyrian_Forgelite deathly_eruption 322256 20444 68 2.94 1164 2327 14.8 14.8 19.0% 0.0% 0.0% 0.0% 1.78sec 20444 301.22sec
Kyrian_Forgelite Kyrian_Forgelite evocation 12051 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 177.68sec 0 301.22sec
Kyrian_Forgelite Kyrian_Forgelite flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Kyrian_Forgelite Kyrian_Forgelite food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Kyrian_Forgelite Kyrian_Forgelite frostbolt 116 1755 6 0.20 1481 2961 0.0 1.0 18.5% 0.0% 0.0% 0.0% 0.00sec 1755 301.22sec
Kyrian_Forgelite Kyrian_Forgelite mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Kyrian_Forgelite Kyrian_Forgelite_mirror_image frostbolt 59638 6087 152 135.00 57 114 90.0 90.0 19.1% 0.0% 0.0% 0.0% 1.29sec 6087 40.00sec
Kyrian_Forgelite Kyrian_Forgelite potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Kyrian_Forgelite Kyrian_Forgelite radiant_spark 307443 33680 112 1.85 3043 6072 9.3 9.3 19.1% 0.0% 0.0% 0.0% 34.02sec 56730 301.22sec
Kyrian_Forgelite Kyrian_Forgelite radiant_spark ticks -307443 23050 77 12.10 319 640 9.3 60.5 19.2% 0.0% 0.0% 0.0% 34.02sec 56730 301.22sec
Kyrian_Forgelite Kyrian_Forgelite rune_of_power 116011 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 53.02sec 0 301.22sec
Kyrian_Forgelite Kyrian_Forgelite touch_of_the_magi 321507 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 54.75sec 0 301.22sec
Kyrian_Forgelite Kyrian_Forgelite touch_of_the_magi_explosion 210833 240076 797 3.54 13500 0 5.9 17.8 0.0% 0.0% 0.0% 0.0% 54.64sec 240076 301.22sec
Kyrian_Forgelite Kyrian_Forgelite use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 123.11sec 0 301.22sec
Kyrian_Forgelite Kyrian_Forgelite_bron anima_cannon 332525 0 0 0.00 0 0 8.4 0.0 0.0% 0.0% 0.0% 0.0% 22.10sec 0 62.68sec
Kyrian_Forgelite Kyrian_Forgelite_bron goliath_support 332526 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 11.94sec 0 62.68sec
Kyrian_Forgelite Kyrian_Forgelite_bron melee 0 4576 73 18.07 202 406 18.9 18.9 19.6% 0.0% 0.0% 0.0% 9.04sec 6536 62.68sec
Kyrian_Forgelite Kyrian_Forgelite_bron smash 341163 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 22.30sec 0 62.68sec
Kyrian_Pelagos Kyrian_Pelagos arcane_barrage 44425 843395 2800 33.16 4247 8524 55.6 166.5 19.1% 0.0% 0.0% 0.0% 5.42sec 843395 301.22sec
Kyrian_Pelagos Kyrian_Pelagos arcane_echo 342232 112011 372 35.51 527 1054 59.4 178.3 19.2% 0.0% 0.0% 0.0% 4.67sec 112011 301.22sec
Kyrian_Pelagos Kyrian_Pelagos arcane_explosion 1449 1522501 5054 89.24 2848 5704 149.3 448.0 19.3% 0.0% 0.0% 0.0% 1.98sec 1522501 301.22sec
Kyrian_Pelagos Kyrian_Pelagos arcane_orb 153626 0 0 0.00 0 0 12.8 0.0 0.0% 0.0% 0.0% 0.0% 24.15sec 0 301.22sec
Kyrian_Pelagos Kyrian_Pelagos arcane_orb_bolt 153640 256992 853 7.65 5615 11207 38.4 38.4 19.3% 0.0% 0.0% 0.0% 24.15sec 256992 301.22sec
Kyrian_Pelagos Kyrian_Pelagos arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 132.25sec 0 301.22sec
Kyrian_Pelagos Kyrian_Pelagos berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 264.32sec 0 301.22sec
Kyrian_Pelagos Kyrian_Pelagos conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Kyrian_Pelagos Kyrian_Pelagos deathly_fixation 322253 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 1.77sec 0 301.22sec
Kyrian_Pelagos Kyrian_Pelagos deathly_eruption 322256 20539 68 2.93 1164 2327 14.7 14.7 20.2% 0.0% 0.0% 0.0% 1.77sec 20539 301.22sec
Kyrian_Pelagos Kyrian_Pelagos evocation 12051 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 179.04sec 0 301.22sec
Kyrian_Pelagos Kyrian_Pelagos flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Kyrian_Pelagos Kyrian_Pelagos food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Kyrian_Pelagos Kyrian_Pelagos frostbolt 116 1753 6 0.20 1481 2961 0.0 1.0 18.4% 0.0% 0.0% 0.0% 0.00sec 1753 301.22sec
Kyrian_Pelagos Kyrian_Pelagos mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Kyrian_Pelagos Kyrian_Pelagos_mirror_image frostbolt 59638 6096 152 135.00 57 114 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 6096 40.00sec
Kyrian_Pelagos Kyrian_Pelagos potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Kyrian_Pelagos Kyrian_Pelagos radiant_spark 307443 33670 112 1.86 3027 6081 9.3 9.3 19.0% 0.0% 0.0% 0.0% 33.78sec 56858 301.22sec
Kyrian_Pelagos Kyrian_Pelagos radiant_spark ticks -307443 23188 77 12.15 320 638 9.3 60.8 19.4% 0.0% 0.0% 0.0% 33.78sec 56858 301.22sec
Kyrian_Pelagos Kyrian_Pelagos rune_of_power 116011 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 52.72sec 0 301.22sec
Kyrian_Pelagos Kyrian_Pelagos touch_of_the_magi 321507 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 54.23sec 0 301.22sec
Kyrian_Pelagos Kyrian_Pelagos touch_of_the_magi_explosion 210833 243606 809 3.55 13676 0 5.9 17.8 0.0% 0.0% 0.0% 0.0% 54.11sec 243606 301.22sec
Kyrian_Pelagos Kyrian_Pelagos use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 124.86sec 0 301.22sec
Necrolord_Emeni Necrolord_Emeni arcane_barrage 44425 691775 2297 29.68 3890 7795 49.7 149.0 19.3% 0.0% 0.0% 0.0% 5.62sec 691775 301.22sec
Necrolord_Emeni Necrolord_Emeni arcane_blast 30451 975868 3240 17.07 9535 19040 29.6 85.7 19.5% 0.0% 0.0% 0.0% 8.08sec 975868 301.22sec
Necrolord_Emeni Necrolord_Emeni arcane_echo 342232 82461 274 22.65 607 1217 37.9 113.7 19.3% 0.0% 0.0% 0.0% 7.46sec 82461 301.22sec
Necrolord_Emeni Necrolord_Emeni arcane_explosion 1449 1210801 4020 77.52 2608 5219 129.7 389.2 19.3% 0.0% 0.0% 0.0% 2.11sec 1210801 301.22sec
Necrolord_Emeni Necrolord_Emeni arcane_orb 153626 0 0 0.00 0 0 11.5 0.0 0.0% 0.0% 0.0% 0.0% 25.05sec 0 301.22sec
Necrolord_Emeni Necrolord_Emeni arcane_orb_bolt 153640 212485 705 6.88 5162 10295 34.5 34.5 19.3% 0.0% 0.0% 0.0% 25.04sec 212485 301.22sec
Necrolord_Emeni Necrolord_Emeni arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 129.41sec 0 301.22sec
Necrolord_Emeni Necrolord_Emeni berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 258.73sec 0 301.22sec
Necrolord_Emeni Necrolord_Emeni conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Necrolord_Emeni Necrolord_Emeni deathborne 324220 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 258.75sec 0 301.22sec
Necrolord_Emeni Necrolord_Emeni deathly_fixation 322253 0 0 0.00 0 0 13.7 0.0 0.0% 0.0% 0.0% 0.0% 1.81sec 0 301.22sec
Necrolord_Emeni Necrolord_Emeni deathly_eruption 322256 19086 63 2.74 1164 2327 13.7 13.7 19.5% 0.0% 0.0% 0.0% 1.81sec 19086 301.22sec
Necrolord_Emeni Necrolord_Emeni evocation 12051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 173.30sec 0 301.22sec
Necrolord_Emeni Necrolord_Emeni flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Necrolord_Emeni Necrolord_Emeni food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Necrolord_Emeni Necrolord_Emeni frostbolt 116 1803 6 0.20 1481 2961 0.0 1.0 21.8% 0.0% 0.0% 0.0% 0.00sec 1803 301.22sec
Necrolord_Emeni Necrolord_Emeni mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Necrolord_Emeni Necrolord_Emeni_mirror_image frostbolt 59638 7049 176 135.00 66 131 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 7049 40.00sec
Necrolord_Emeni Necrolord_Emeni potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Necrolord_Emeni Necrolord_Emeni presence_of_mind 205025 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 257.54sec 0 301.22sec
Necrolord_Emeni Necrolord_Emeni rune_of_power 116011 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 50.91sec 0 301.22sec
Necrolord_Emeni Necrolord_Emeni touch_of_the_magi 321507 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 52.58sec 0 301.22sec
Necrolord_Emeni Necrolord_Emeni touch_of_the_magi_explosion 210833 290495 964 3.65 15859 0 6.1 18.3 0.0% 0.0% 0.0% 0.0% 52.47sec 290495 301.22sec
Necrolord_Emeni Necrolord_Emeni use_mana_gem 5405 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.97sec 0 301.22sec
Necrolord_Marileth Necrolord_Marileth arcane_barrage 44425 676081 2244 29.70 3798 7603 49.8 149.1 19.4% 0.0% 0.0% 0.0% 5.62sec 676081 301.22sec
Necrolord_Marileth Necrolord_Marileth arcane_blast 30451 812841 2698 17.09 7948 15879 29.7 85.8 19.2% 0.0% 0.0% 0.0% 7.95sec 812841 301.22sec
Necrolord_Marileth Necrolord_Marileth arcane_echo 342232 74877 249 22.66 552 1103 37.9 113.7 19.3% 0.0% 0.0% 0.0% 7.59sec 74877 301.22sec
Necrolord_Marileth Necrolord_Marileth arcane_explosion 1449 1191841 3957 77.41 2570 5145 129.6 388.7 19.3% 0.0% 0.0% 0.0% 2.11sec 1191841 301.22sec
Necrolord_Marileth Necrolord_Marileth arcane_orb 153626 0 0 0.00 0 0 11.6 0.0 0.0% 0.0% 0.0% 0.0% 24.98sec 0 301.22sec
Necrolord_Marileth Necrolord_Marileth arcane_orb_bolt 153640 206481 685 6.89 5007 10033 34.6 34.6 19.1% 0.0% 0.0% 0.0% 24.99sec 206481 301.22sec
Necrolord_Marileth Necrolord_Marileth arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 129.48sec 0 301.22sec
Necrolord_Marileth Necrolord_Marileth berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 258.89sec 0 301.22sec
Necrolord_Marileth Necrolord_Marileth conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Necrolord_Marileth Necrolord_Marileth deathborne 324220 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 258.94sec 0 301.22sec
Necrolord_Marileth Necrolord_Marileth deathly_fixation 322253 0 0 0.00 0 0 13.7 0.0 0.0% 0.0% 0.0% 0.0% 1.81sec 0 301.22sec
Necrolord_Marileth Necrolord_Marileth deathly_eruption 322256 18943 63 2.72 1164 2327 13.7 13.7 19.2% 0.0% 0.0% 0.0% 1.81sec 18943 301.22sec
Necrolord_Marileth Necrolord_Marileth evocation 12051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.01sec 0 301.22sec
Necrolord_Marileth Necrolord_Marileth flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Necrolord_Marileth Necrolord_Marileth food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Necrolord_Marileth Necrolord_Marileth frostbolt 116 1764 6 0.20 1481 2961 0.0 1.0 19.1% 0.0% 0.0% 0.0% 0.00sec 1764 301.22sec
Necrolord_Marileth Necrolord_Marileth mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Necrolord_Marileth Necrolord_Marileth_mirror_image frostbolt 59638 6034 151 135.00 56 113 90.0 90.0 19.2% 0.0% 0.0% 0.0% 1.29sec 6034 40.00sec
Necrolord_Marileth Necrolord_Marileth potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Necrolord_Marileth Necrolord_Marileth presence_of_mind 205025 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 257.76sec 0 301.22sec
Necrolord_Marileth Necrolord_Marileth rune_of_power 116011 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 51.00sec 0 301.22sec
Necrolord_Marileth Necrolord_Marileth touch_of_the_magi 321507 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 52.52sec 0 301.22sec
Necrolord_Marileth Necrolord_Marileth touch_of_the_magi_explosion 210833 259077 860 3.65 14142 0 6.1 18.3 0.0% 0.0% 0.0% 0.0% 52.42sec 259077 301.22sec
Necrolord_Marileth Necrolord_Marileth use_mana_gem 5405 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.87sec 0 301.22sec
NightFae_Dream NightFae_Dream arcane_barrage 44425 848891 2818 32.48 4366 8738 54.4 163.0 19.2% 0.0% 0.0% 0.0% 5.55sec 848891 301.22sec
NightFae_Dream NightFae_Dream arcane_echo 342232 87008 289 24.79 586 1173 41.5 124.5 19.3% 0.0% 0.0% 0.0% 6.89sec 87008 301.22sec
NightFae_Dream NightFae_Dream arcane_explosion 1449 1522924 5056 85.53 2973 5953 143.1 429.4 19.2% 0.0% 0.0% 0.0% 2.07sec 1522924 301.22sec
NightFae_Dream NightFae_Dream arcane_orb 153626 0 0 0.00 0 0 13.9 0.0 0.0% 0.0% 0.0% 0.0% 22.33sec 0 301.22sec
NightFae_Dream NightFae_Dream arcane_orb_bolt 153640 265787 882 8.30 5336 10695 41.7 41.7 19.5% 0.0% 0.0% 0.0% 22.34sec 265787 301.22sec
NightFae_Dream NightFae_Dream arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 97.22sec 0 301.22sec
NightFae_Dream NightFae_Dream berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.74sec 0 301.22sec
NightFae_Dream NightFae_Dream conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
NightFae_Dream NightFae_Dream deathly_fixation 322253 0 0 0.00 0 0 18.8 0.0 0.0% 0.0% 0.0% 0.0% 9.38sec 0 301.22sec
NightFae_Dream NightFae_Dream deathly_eruption 322256 26084 87 3.74 1164 2327 18.8 18.8 19.5% 0.0% 0.0% 0.0% 9.38sec 26084 301.22sec
NightFae_Dream NightFae_Dream evocation 12051 0 0 0.00 0 0 0.3 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
NightFae_Dream NightFae_Dream flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
NightFae_Dream NightFae_Dream food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
NightFae_Dream NightFae_Dream frostbolt 116 1779 6 0.20 1481 2961 0.0 1.0 20.2% 0.0% 0.0% 0.0% 0.00sec 1779 301.22sec
NightFae_Dream NightFae_Dream mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
NightFae_Dream NightFae_Dream_mirror_image frostbolt 59638 6030 151 135.00 56 112 90.0 90.0 19.2% 0.0% 0.0% 0.0% 1.29sec 6030 40.00sec
NightFae_Dream NightFae_Dream potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.49sec 0 301.22sec
NightFae_Dream NightFae_Dream rune_of_power 116011 0 0 0.00 0 0 6.4 0.0 0.0% 0.0% 0.0% 0.0% 48.04sec 0 301.22sec
NightFae_Dream NightFae_Dream shifting_power ticks -314791 116205 387 4.74 1372 2745 6.0 23.7 19.2% 0.0% 0.0% 0.0% 49.55sec 116205 301.22sec
NightFae_Dream NightFae_Dream touch_of_the_magi 321507 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 49.15sec 0 301.22sec
NightFae_Dream NightFae_Dream touch_of_the_magi_explosion 210833 224441 745 3.91 11416 0 6.6 19.7 0.0% 0.0% 0.0% 0.0% 48.98sec 224441 301.22sec
NightFae_Dream NightFae_Dream use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.61sec 0 301.22sec
NightFae_Dream_SB NightFae_Dream_SB arcane_barrage 44425 860662 2857 32.48 4421 8867 54.4 163.0 19.3% 0.0% 0.0% 0.0% 5.56sec 860662 301.22sec
NightFae_Dream_SB NightFae_Dream_SB arcane_echo 342232 88167 293 24.79 593 1188 41.5 124.5 19.4% 0.0% 0.0% 0.0% 6.89sec 88167 301.22sec
NightFae_Dream_SB NightFae_Dream_SB arcane_explosion 1449 1542669 5121 85.52 3015 6014 143.1 429.3 19.3% 0.0% 0.0% 0.0% 2.07sec 1542669 301.22sec
NightFae_Dream_SB NightFae_Dream_SB arcane_orb 153626 0 0 0.00 0 0 13.9 0.0 0.0% 0.0% 0.0% 0.0% 22.36sec 0 301.22sec
NightFae_Dream_SB NightFae_Dream_SB arcane_orb_bolt 153640 268362 891 8.30 5404 10838 41.6 41.6 19.1% 0.0% 0.0% 0.0% 22.36sec 268362 301.22sec
NightFae_Dream_SB NightFae_Dream_SB arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 97.18sec 0 301.22sec
NightFae_Dream_SB NightFae_Dream_SB berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.61sec 0 301.22sec
NightFae_Dream_SB NightFae_Dream_SB conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
NightFae_Dream_SB NightFae_Dream_SB deathly_fixation 322253 0 0 0.00 0 0 18.9 0.0 0.0% 0.0% 0.0% 0.0% 9.18sec 0 301.22sec
NightFae_Dream_SB NightFae_Dream_SB deathly_eruption 322256 26625 88 3.76 1181 2363 18.9 18.9 19.3% 0.0% 0.0% 0.0% 9.18sec 26625 301.22sec
NightFae_Dream_SB NightFae_Dream_SB evocation 12051 0 0 0.00 0 0 0.3 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
NightFae_Dream_SB NightFae_Dream_SB flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
NightFae_Dream_SB NightFae_Dream_SB food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
NightFae_Dream_SB NightFae_Dream_SB frostbolt 116 1849 6 0.20 1520 3040 0.0 1.0 21.6% 0.0% 0.0% 0.0% 0.00sec 1849 301.22sec
NightFae_Dream_SB NightFae_Dream_SB mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
NightFae_Dream_SB NightFae_Dream_SB_mirror_image frostbolt 59638 6112 153 135.00 57 114 90.0 90.0 19.2% 0.0% 0.0% 0.0% 1.29sec 6112 40.00sec
NightFae_Dream_SB NightFae_Dream_SB potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.46sec 0 301.22sec
NightFae_Dream_SB NightFae_Dream_SB rune_of_power 116011 0 0 0.00 0 0 6.4 0.0 0.0% 0.0% 0.0% 0.0% 48.01sec 0 301.22sec
NightFae_Dream_SB NightFae_Dream_SB shifting_power ticks -314791 118184 394 4.74 1394 2788 6.0 23.7 19.3% 0.0% 0.0% 0.0% 49.52sec 118184 301.22sec
NightFae_Dream_SB NightFae_Dream_SB touch_of_the_magi 321507 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 49.15sec 0 301.22sec
NightFae_Dream_SB NightFae_Dream_SB touch_of_the_magi_explosion 210833 227946 757 3.92 11589 0 6.6 19.7 0.0% 0.0% 0.0% 0.0% 48.99sec 227946 301.22sec
NightFae_Dream_SB NightFae_Dream_SB use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.57sec 0 301.22sec
NightFae_Niya NightFae_Niya arcane_barrage 44425 864084 2869 32.57 4428 8850 54.6 163.5 19.3% 0.0% 0.0% 0.0% 5.53sec 864084 301.22sec
NightFae_Niya NightFae_Niya arcane_echo 342232 87147 289 24.82 586 1170 41.5 124.6 19.4% 0.0% 0.0% 0.0% 6.88sec 87147 301.22sec
NightFae_Niya NightFae_Niya arcane_explosion 1449 1562138 5186 85.76 3043 6076 143.5 430.5 19.3% 0.0% 0.0% 0.0% 2.07sec 1562138 301.22sec
NightFae_Niya NightFae_Niya arcane_orb 153626 0 0 0.00 0 0 14.0 0.0 0.0% 0.0% 0.0% 0.0% 22.20sec 0 301.22sec
NightFae_Niya NightFae_Niya arcane_orb_bolt 153640 271294 901 8.35 5439 10854 41.9 41.9 19.1% 0.0% 0.0% 0.0% 22.19sec 271294 301.22sec
NightFae_Niya NightFae_Niya arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 97.19sec 0 301.22sec
NightFae_Niya NightFae_Niya berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.78sec 0 301.22sec
NightFae_Niya NightFae_Niya conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
NightFae_Niya NightFae_Niya deathly_fixation 322253 0 0 0.00 0 0 18.8 0.0 0.0% 0.0% 0.0% 0.0% 9.01sec 0 301.22sec
NightFae_Niya NightFae_Niya deathly_eruption 322256 26179 87 3.75 1164 2327 18.8 18.8 19.4% 0.0% 0.0% 0.0% 9.01sec 26179 301.22sec
NightFae_Niya NightFae_Niya evocation 12051 0 0 0.00 0 0 0.1 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
NightFae_Niya NightFae_Niya flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
NightFae_Niya NightFae_Niya food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
NightFae_Niya NightFae_Niya frostbolt 116 1766 6 0.20 1481 2961 0.0 1.0 19.2% 0.0% 0.0% 0.0% 0.00sec 1766 301.22sec
NightFae_Niya NightFae_Niya mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
NightFae_Niya NightFae_Niya_mirror_image frostbolt 59638 6043 151 135.00 56 113 90.0 90.0 19.4% 0.0% 0.0% 0.0% 1.29sec 6043 40.00sec
NightFae_Niya NightFae_Niya potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.40sec 0 301.22sec
NightFae_Niya NightFae_Niya rune_of_power 116011 0 0 0.00 0 0 6.4 0.0 0.0% 0.0% 0.0% 0.0% 48.11sec 0 301.22sec
NightFae_Niya NightFae_Niya shifting_power ticks -314791 116247 387 4.73 1372 2745 6.0 23.7 19.3% 0.0% 0.0% 0.0% 49.58sec 116247 301.22sec
NightFae_Niya NightFae_Niya touch_of_the_magi 321507 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 49.16sec 0 301.22sec
NightFae_Niya NightFae_Niya touch_of_the_magi_explosion 210833 229642 762 3.92 11672 0 6.6 19.7 0.0% 0.0% 0.0% 0.0% 48.98sec 229642 301.22sec
NightFae_Niya NightFae_Niya use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.62sec 0 301.22sec
Venthyr_Nadjia Venthyr_Nadjia arcane_barrage 44425 858816 2851 34.51 4157 8273 57.8 173.3 19.4% 0.0% 0.0% 0.0% 5.20sec 858816 301.22sec
Venthyr_Nadjia Venthyr_Nadjia arcane_echo 342232 83094 276 25.95 535 1069 43.4 130.3 19.3% 0.0% 0.0% 0.0% 6.45sec 83094 301.22sec
Venthyr_Nadjia Venthyr_Nadjia arcane_explosion 1449 1568365 5207 94.00 2785 5572 157.3 471.9 19.3% 0.0% 0.0% 0.0% 1.88sec 1568365 301.22sec
Venthyr_Nadjia Venthyr_Nadjia arcane_orb 153626 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.40sec 0 301.22sec
Venthyr_Nadjia Venthyr_Nadjia arcane_orb_bolt 153640 256653 852 7.90 5430 10863 39.7 39.7 19.2% 0.0% 0.0% 0.0% 23.40sec 256653 301.22sec
Venthyr_Nadjia Venthyr_Nadjia arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 127.34sec 0 301.22sec
Venthyr_Nadjia Venthyr_Nadjia berserking 26297 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 254.44sec 0 301.22sec
Venthyr_Nadjia Venthyr_Nadjia conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Venthyr_Nadjia Venthyr_Nadjia deathly_fixation 322253 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 1.77sec 0 301.22sec
Venthyr_Nadjia Venthyr_Nadjia deathly_eruption 322256 20281 67 2.92 1164 2327 14.7 14.7 18.9% 0.0% 0.0% 0.0% 1.77sec 20281 301.22sec
Venthyr_Nadjia Venthyr_Nadjia evocation 12051 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 185.69sec 0 301.22sec
Venthyr_Nadjia Venthyr_Nadjia flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Venthyr_Nadjia Venthyr_Nadjia food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Venthyr_Nadjia Venthyr_Nadjia frostbolt 116 1735 6 0.20 1481 2961 0.0 1.0 17.2% 0.0% 0.0% 0.0% 0.00sec 1735 301.22sec
Venthyr_Nadjia Venthyr_Nadjia mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Venthyr_Nadjia Venthyr_Nadjia_mirror_image frostbolt 59638 6095 152 135.00 57 113 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 6095 40.00sec
Venthyr_Nadjia Venthyr_Nadjia mirrors_of_torment 314793 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 129.66sec 0 301.22sec
Venthyr_Nadjia Venthyr_Nadjia agonizing_backlash 320035 20967 70 1.13 3109 6120 5.7 5.7 19.4% 0.0% 0.0% 0.0% 52.64sec 20967 301.22sec
Venthyr_Nadjia Venthyr_Nadjia tormenting_backlash 317589 26569 88 0.55 8084 16137 2.8 2.8 18.8% 0.0% 0.0% 0.0% 132.09sec 26569 301.22sec
Venthyr_Nadjia Venthyr_Nadjia potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Venthyr_Nadjia Venthyr_Nadjia rune_of_power 116011 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 50.36sec 0 301.22sec
Venthyr_Nadjia Venthyr_Nadjia touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 51.96sec 0 301.22sec
Venthyr_Nadjia Venthyr_Nadjia touch_of_the_magi_explosion 210833 209484 695 3.68 11339 0 6.2 18.5 0.0% 0.0% 0.0% 0.0% 51.90sec 209484 301.22sec
Venthyr_Nadjia Venthyr_Nadjia use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 123.89sec 0 301.22sec
Venthyr_Theotar Venthyr_Theotar arcane_barrage 44425 854871 2838 34.15 4181 8344 57.2 171.5 19.3% 0.0% 0.0% 0.0% 5.26sec 854871 301.22sec
Venthyr_Theotar Venthyr_Theotar arcane_echo 342232 81669 271 25.59 533 1066 42.8 128.5 19.3% 0.0% 0.0% 0.0% 6.55sec 81669 301.22sec
Venthyr_Theotar Venthyr_Theotar arcane_explosion 1449 1571584 5217 92.23 2846 5691 154.4 463.1 19.3% 0.0% 0.0% 0.0% 1.92sec 1571584 301.22sec
Venthyr_Theotar Venthyr_Theotar arcane_orb 153626 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.49sec 0 301.22sec
Venthyr_Theotar Venthyr_Theotar arcane_orb_bolt 153640 260155 864 7.87 5522 11042 39.5 39.5 19.3% 0.0% 0.0% 0.0% 23.49sec 260155 301.22sec
Venthyr_Theotar Venthyr_Theotar arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 129.20sec 0 301.22sec
Venthyr_Theotar Venthyr_Theotar berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 258.55sec 0 301.22sec
Venthyr_Theotar Venthyr_Theotar conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Venthyr_Theotar Venthyr_Theotar deathly_fixation 322253 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 1.79sec 0 301.22sec
Venthyr_Theotar Venthyr_Theotar deathly_eruption 322256 20288 67 2.91 1164 2327 14.6 14.6 19.4% 0.0% 0.0% 0.0% 1.79sec 20288 301.22sec
Venthyr_Theotar Venthyr_Theotar evocation 12051 0 0 0.00 0 0 0.8 0.0 0.0% 0.0% 0.0% 0.0% 142.83sec 0 301.22sec
Venthyr_Theotar Venthyr_Theotar flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Venthyr_Theotar Venthyr_Theotar food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Venthyr_Theotar Venthyr_Theotar frostbolt 116 1767 6 0.20 1481 2961 0.0 1.0 19.4% 0.0% 0.0% 0.0% 0.00sec 1767 301.22sec
Venthyr_Theotar Venthyr_Theotar mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Venthyr_Theotar Venthyr_Theotar_mirror_image frostbolt 59638 6093 152 135.00 57 114 90.0 90.0 19.2% 0.0% 0.0% 0.0% 1.29sec 6093 40.00sec
Venthyr_Theotar Venthyr_Theotar mirrors_of_torment 314793 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 141.48sec 0 301.22sec
Venthyr_Theotar Venthyr_Theotar agonizing_backlash 320035 19262 64 1.05 3033 6170 5.3 5.3 19.3% 0.0% 0.0% 0.0% 56.14sec 19262 301.22sec
Venthyr_Theotar Venthyr_Theotar tormenting_backlash 317589 24438 81 0.51 7990 15984 2.6 2.6 18.8% 0.0% 0.0% 0.0% 143.46sec 24438 301.22sec
Venthyr_Theotar Venthyr_Theotar potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
Venthyr_Theotar Venthyr_Theotar rune_of_power 116011 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 51.48sec 0 301.22sec
Venthyr_Theotar Venthyr_Theotar touch_of_the_magi 321507 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 52.88sec 0 301.22sec
Venthyr_Theotar Venthyr_Theotar touch_of_the_magi_explosion 210833 212321 705 3.62 11695 0 6.1 18.2 0.0% 0.0% 0.0% 0.0% 52.71sec 212321 301.22sec
Venthyr_Theotar Venthyr_Theotar use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.02sec 0 301.22sec
arcane arcane arcane_barrage 44425 849088 2819 34.30 4140 8266 57.5 172.2 19.2% 0.0% 0.0% 0.0% 5.25sec 849088 301.22sec
arcane arcane arcane_echo 342232 70325 233 22.05 532 1063 36.9 110.7 19.5% 0.0% 0.0% 0.0% 7.72sec 70325 301.22sec
arcane arcane arcane_explosion 1449 1552196 5153 92.90 2789 5579 155.5 466.4 19.3% 0.0% 0.0% 0.0% 1.91sec 1552196 301.22sec
arcane arcane arcane_orb 153626 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.67sec 0 301.22sec
arcane arcane arcane_orb_bolt 153640 256683 852 7.85 5463 10886 39.4 39.4 19.4% 0.0% 0.0% 0.0% 23.67sec 256683 301.22sec
arcane arcane arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 128.39sec 0 301.22sec
arcane arcane berserking 26297 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 256.47sec 0 301.22sec
arcane arcane conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
arcane arcane deathly_fixation 322253 0 0 0.00 0 0 14.4 0.0 0.0% 0.0% 0.0% 0.0% 1.78sec 0 301.22sec
arcane arcane deathly_eruption 322256 20008 66 2.88 1164 2327 14.4 14.4 19.1% 0.0% 0.0% 0.0% 1.78sec 20008 301.22sec
arcane arcane evocation 12051 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 173.40sec 0 301.22sec
arcane arcane flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
arcane arcane food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
arcane arcane frostbolt 116 1768 6 0.20 1481 2961 0.0 1.0 19.4% 0.0% 0.0% 0.0% 0.00sec 1768 301.22sec
arcane arcane mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
arcane arcane_mirror_image frostbolt 59638 6043 151 135.00 56 112 90.0 90.0 19.4% 0.0% 0.0% 0.0% 1.29sec 6043 40.00sec
arcane arcane potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.22sec
arcane arcane rune_of_power 116011 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 50.93sec 0 301.22sec
arcane arcane touch_of_the_magi 321507 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 52.47sec 0 301.22sec
arcane arcane touch_of_the_magi_explosion 210833 136744 454 3.66 7434 0 6.1 18.4 0.0% 0.0% 0.0% 0.0% 52.36sec 136744 301.22sec
arcane arcane use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 123.51sec 0 301.22sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
40456.4 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 51.3sec 11.42% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 142.4s

Stack Uptimes

  • Health Decade (0 - 10)_1:11.44%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 28.2sec 8.13% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 47.1s

Stack Uptimes

  • Health Decade (10 - 20)_1:8.14%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 32.6sec 10.65% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 44.9s

Stack Uptimes

  • Health Decade (20 - 30)_1:10.65%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 36.2sec 12.16% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.8s / 49.1s

Stack Uptimes

  • Health Decade (30 - 40)_1:12.16%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 34.0sec 11.45% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:22.4s / 46.5s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.45%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 33.5sec 11.28% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.0s / 41.7s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.28%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.5sec 12.64% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.8s / 45.6s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.64%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 37.6sec 12.64% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:19.6s / 50.7s

Stack Uptimes

  • Health Decade (70 - 80)_1:12.64%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 18.2sec 6.14% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:7.7s / 33.7s

Stack Uptimes

  • Health Decade (80 - 90)_1:6.14%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 13.4sec 3.50% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.1s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:3.50%
Mirrors of Torment 2.7 0.0 137.5sec 138.3sec 13.2sec 11.77% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_mirrors_of_torment
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.50

Trigger Details

  • interval_min/max:1.3s / 165.8s
  • trigger_min/max:97.1s / 165.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 13.5s

Stack Uptimes

  • mirrors_of_torment_1:5.17%
  • mirrors_of_torment_2:5.27%
  • mirrors_of_torment_3:1.33%

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by $320035s3%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict $320035s1 Shadow damage and their movement and cast speed are slowed by $320035s3%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict $317589s1 Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain $345417s1% mana][]$?c2[your Fire Blast cooldown is reduced by $s2 sec][]$?c3[you gain Brain Freeze][].
  • max_stacks:0
  • duration:25.00
  • cooldown:90.00
  • default_chance:100.00%
Mirrors of Torment 2.9 0.0 128.5sec 129.2sec 13.2sec 12.67% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_mirrors_of_torment
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.50

Trigger Details

  • interval_min/max:1.3s / 162.6s
  • trigger_min/max:93.8s / 162.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.5s

Stack Uptimes

  • mirrors_of_torment_1:5.56%
  • mirrors_of_torment_2:5.67%
  • mirrors_of_torment_3:1.44%

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by $320035s3%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict $320035s1 Shadow damage and their movement and cast speed are slowed by $320035s3%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict $317589s1 Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain $345417s1% mana][]$?c2[your Fire Blast cooldown is reduced by $s2 sec][]$?c3[you gain Brain Freeze][].
  • max_stacks:0
  • duration:25.00
  • cooldown:90.00
  • default_chance:100.00%
Radiant Spark Vulnerability 9.4 27.7 33.2sec 7.9sec 4.8sec 14.88% 0.00% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_radiant_spark_vulnerability
  • max_stacks:4
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.7s / 59.5s
  • trigger_min/max:0.5s / 54.0s
  • trigger_pct:99.99%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • radiant_spark_vulnerability_1:3.87%
  • radiant_spark_vulnerability_2:3.74%
  • radiant_spark_vulnerability_3:3.54%
  • radiant_spark_vulnerability_4:3.73%

Spelldata

  • id:307454
  • name:Radiant Spark Vulnerability
  • tooltip:Damage taken from $@auracaster increased by $w1%.
  • description:{$@spelldesc307443=Conjure a radiant spark that causes $s1 Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes $307454s1% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells. }
  • max_stacks:4
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Radiant Spark Vulnerability 9.4 27.5 33.4sec 7.9sec 4.8sec 14.83% 0.00% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_radiant_spark_vulnerability
  • max_stacks:4
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.7s / 59.5s
  • trigger_min/max:0.5s / 54.0s
  • trigger_pct:99.99%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • radiant_spark_vulnerability_1:3.84%
  • radiant_spark_vulnerability_2:3.74%
  • radiant_spark_vulnerability_3:3.52%
  • radiant_spark_vulnerability_4:3.74%

Spelldata

  • id:307454
  • name:Radiant Spark Vulnerability
  • tooltip:Damage taken from $@auracaster increased by $w1%.
  • description:{$@spelldesc307443=Conjure a radiant spark that causes $s1 Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes $307454s1% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells. }
  • max_stacks:4
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Touch of the Magi 6.1 0.0 52.3sec 52.4sec 7.9sec 16.19% 0.00% 0.0 (0.0) 6.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 73.9s
  • trigger_min/max:46.3s / 73.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.19%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.6 0.0 49.0sec 49.1sec 7.9sec 17.24% 0.00% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 59.0s
  • trigger_min/max:39.0s / 59.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:17.24%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.6 0.0 49.1sec 49.1sec 7.9sec 17.23% 0.00% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 62.9s
  • trigger_min/max:38.9s / 62.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:17.23%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.6 0.0 49.1sec 49.1sec 7.9sec 17.23% 0.00% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 59.0s
  • trigger_min/max:38.9s / 59.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:17.23%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.1 0.0 52.9sec 53.0sec 7.9sec 15.97% 0.00% 0.0 (0.0) 5.9

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 73.6s
  • trigger_min/max:46.3s / 73.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:15.97%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 51.9sec 52.0sec 7.9sec 16.27% 0.00% 0.0 (0.0) 6.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 71.9s
  • trigger_min/max:46.3s / 71.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.27%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 5.9 0.0 54.2sec 54.3sec 7.9sec 15.62% 0.00% 0.0 (0.0) 5.8

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 77.5s
  • trigger_min/max:47.4s / 77.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:15.62%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 5.9 0.0 54.5sec 54.6sec 7.9sec 15.59% 0.00% 0.0 (0.0) 5.8

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 76.2s
  • trigger_min/max:47.4s / 76.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:15.59%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.1 0.0 52.4sec 52.5sec 7.9sec 16.16% 0.00% 0.0 (0.0) 6.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 74.1s
  • trigger_min/max:46.3s / 74.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.16%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.1 0.0 52.4sec 52.5sec 7.9sec 16.15% 0.00% 0.0 (0.0) 6.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 74.1s
  • trigger_min/max:46.3s / 74.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.15%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 1523
Mean 301.22
Minimum 240.15
Maximum 359.98
Spread ( max - min ) 119.83
Range [ ( max - min ) / 2 * 100% ] 19.89%
DPS
Fluffy_Pillow Damage Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 1523
Mean 43059.79
Minimum 41263.36
Maximum 45102.55
Spread ( max - min ) 3839.19
Range [ ( max - min ) / 2 * 100% ] 4.46%
Standard Deviation 717.2030
5th Percentile 41942.44
95th Percentile 44216.05
( 95th Percentile - 5th Percentile ) 2273.61
Mean Distribution
Standard Deviation 18.3777
95.00% Confidence Interval ( 43023.77 - 43095.81 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1066
0.1 Scale Factor Error with Delta=300 4392
0.05 Scale Factor Error with Delta=300 17565
0.01 Scale Factor Error with Delta=300 439105
HPS
Fluffy_Pillow Healing Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 106
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 15218432 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
28168.0 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 52.0sec 11.72% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 144.5s

Stack Uptimes

  • Health Decade (0 - 10)_1:11.73%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 28.7sec 8.42% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 45.7s

Stack Uptimes

  • Health Decade (10 - 20)_1:8.42%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 32.4sec 10.68% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.7s / 43.0s

Stack Uptimes

  • Health Decade (20 - 30)_1:10.68%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 35.1sec 11.80% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:21.8s / 48.4s

Stack Uptimes

  • Health Decade (30 - 40)_1:11.80%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 33.0sec 11.09% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:21.8s / 45.0s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.09%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 32.0sec 10.77% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:26.6s / 40.5s

Stack Uptimes

  • Health Decade (50 - 60)_1:10.77%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 35.9sec 12.09% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:27.8s / 44.0s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.09%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 37.5sec 12.63% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:21.1s / 47.6s

Stack Uptimes

  • Health Decade (70 - 80)_1:12.63%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 21.0sec 7.05% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:10.3s / 36.7s

Stack Uptimes

  • Health Decade (80 - 90)_1:7.05%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 14.2sec 3.75% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.3s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:3.75%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 2436
death count pct 158.28
avg death time 300.83
min death time 240.87
max death time 359.13
dmg taken 9040263.43

Statistics & Data Analysis

Fight Length
enemy2 Fight Length
Count 1523
Mean 301.22
Minimum 240.15
Maximum 359.98
Spread ( max - min ) 119.83
Range [ ( max - min ) / 2 * 100% ] 19.89%
DPS
enemy2 Damage Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy2 Priority Target Damage Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy2 Damage Per Second (Effective)
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy2 Damage
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy2 Damage Taken Per Second
Count 1523
Mean 30029.02
Minimum 28976.93
Maximum 31088.73
Spread ( max - min ) 2111.80
Range [ ( max - min ) / 2 * 100% ] 3.52%
Standard Deviation 420.2537
5th Percentile 29370.77
95th Percentile 30718.45
( 95th Percentile - 5th Percentile ) 1347.68
Mean Distribution
Standard Deviation 10.7687
95.00% Confidence Interval ( 30007.91 - 30050.12 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 8
0.1% Error 753
0.1 Scale Factor Error with Delta=300 1508
0.05 Scale Factor Error with Delta=300 6031
0.01 Scale Factor Error with Delta=300 150768
HPS
enemy2 Healing Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy2 Healing Per Second (Effective)
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy2 Heal
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy2 Healing Taken Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy2 Theck-Meloree Index
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy2Theck-Meloree Index (Effective)
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy2 Max Spike Value
Count 106
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 10334773 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy2"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy3 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
28818.0 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 52.6sec 12.01% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 145.4s

Stack Uptimes

  • Health Decade (0 - 10)_1:12.03%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 28.9sec 8.59% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.7s

Stack Uptimes

  • Health Decade (10 - 20)_1:8.60%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 33.3sec 10.98% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 44.0s

Stack Uptimes

  • Health Decade (20 - 30)_1:10.98%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 35.6sec 11.98% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:22.1s / 49.9s

Stack Uptimes

  • Health Decade (30 - 40)_1:11.98%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 33.5sec 11.27% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.4s / 45.9s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.27%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 33.1sec 11.12% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.5s / 41.7s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.12%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.2sec 12.51% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 44.9s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.51%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 36.3sec 12.20% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.5s / 50.7s

Stack Uptimes

  • Health Decade (70 - 80)_1:12.20%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 17.1sec 5.77% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:7.8s / 29.3s

Stack Uptimes

  • Health Decade (80 - 90)_1:5.77%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 13.6sec 3.57% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.3s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:3.57%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 2436
death count pct 158.28
avg death time 300.83
min death time 240.87
max death time 359.13
dmg taken 9249450.82

Statistics & Data Analysis

Fight Length
enemy3 Fight Length
Count 1523
Mean 301.22
Minimum 240.15
Maximum 359.98
Spread ( max - min ) 119.83
Range [ ( max - min ) / 2 * 100% ] 19.89%
DPS
enemy3 Damage Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy3 Priority Target Damage Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy3 Damage Per Second (Effective)
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy3 Damage
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy3 Damage Taken Per Second
Count 1523
Mean 30726.64
Minimum 29549.19
Maximum 31852.41
Spread ( max - min ) 2303.22
Range [ ( max - min ) / 2 * 100% ] 3.75%
Standard Deviation 420.1356
5th Percentile 30031.60
95th Percentile 31391.14
( 95th Percentile - 5th Percentile ) 1359.53
Mean Distribution
Standard Deviation 10.7656
95.00% Confidence Interval ( 30705.54 - 30747.74 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 8
0.1% Error 719
0.1 Scale Factor Error with Delta=300 1507
0.05 Scale Factor Error with Delta=300 6028
0.01 Scale Factor Error with Delta=300 150683
HPS
enemy3 Healing Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy3 Healing Per Second (Effective)
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy3 Heal
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy3 Healing Taken Per Second
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy3 Theck-Meloree Index
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy3Theck-Meloree Index (Effective)
Count 1523
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy3 Max Spike Value
Count 106
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 9693548 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy3"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.